Human NPB/L7/PPL7 ORF/cDNA clone-Lentivirus particle (NM_148896)

Cat. No.: vGMLP001823

Pre-made Human NPB/L7/PPL7 Lentiviral expression plasmid for NPB lentivirus packaging, NPB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to NPB/L7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001823 Human NPB Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001823
Gene Name NPB
Accession Number NM_148896
Gene ID 256933
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 378 bp
Gene Alias L7,PPL7,PPNPB
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCGGTCCGCGACACTGGCGGCCGCCGCCCTGGCGCTGTGCCTGCTGCTGGCGCCGCCTGGCCTCGCGTGGTACAAGCCAGCGGCGGGGCACAGCTCCTACTCGGTGGGCCGCGCCGCGGGGCTGCTGTCCGGCCTCCGCAGGTCCCCGTACGCGCGGCGCTCCCAGCCCTACAGAGGGGCGGAACCCCCGGGCGGGGCCGGCGCCTCCCCGGAGCTGCAACTGCACCCCAGGCTGCGGAGCCTCGCTGTGTGCGTCCAGGACGTCGCCCCAAACCTGCAGAGGTGCGAGCGGCTCCCCGACGGCCGCGGGACCTACCAGTGCAAGGCGAACGTCTTCCTGTCCCTGCGCGCAGCCGACTGCCTCGCCGCCTGA
ORF Protein Sequence MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYRGAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAADCLAA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0372-Ab Anti-NPB/ L7/ PPL7 functional antibody
    Target Antigen GM-Tg-g-SE0372-Ag NPB protein
    ORF Viral Vector pGMLP001823 Human NPB Lentivirus plasmid
    ORF Viral Vector vGMLP001823 Human NPB Lentivirus particle


    Target information

    Target ID GM-SE0372
    Target Name NPB
    Gene ID 256933, 208990, 714956, 259222, 111557817, 100855442, 280880, 111775559
    Gene Symbol and Synonyms L7,mPPL7,NPB,PPL7,PPNPB
    Uniprot Accession Q8NG41
    Uniprot Entry Name NPB_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000183979
    Target Classification Not Available

    This gene encodes a member of the neuropeptide B/W family of proteins and preproprotein that is proteolytically processed to generate multiple protein products. The encoded products include neuropeptide B-23 and a C-terminally extended form, neuropeptide B-29, which are characterized by an N-terminal brominated tryptophan amino acid. Both of the encoded peptides bind with higher affinity to neuropeptide B/W (NPB/W) receptor 1 compared to the related NPB/W receptor 2. These peptides may regulate feeding, pain perception, and stress in rodents. [provided by RefSeq, Jul 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.