Human B4GALT5/B4Gal-T5/BETA4-GALT-IV ORF/cDNA clone-Lentivirus particle (NM_004776.3)

Cat. No.: vGMLP001915

Pre-made Human B4GALT5/B4Gal-T5/BETA4-GALT-IV Lentiviral expression plasmid for B4GALT5 lentivirus packaging, B4GALT5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to B4GALT5/B4Gal-T5 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001915 Human B4GALT5 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001915
Gene Name B4GALT5
Accession Number NM_004776.3
Gene ID 9334
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1167 bp
Gene Alias B4Gal-T5,BETA4-GALT-IV,beta4Gal-T5,beta4GalT-V,gt-V
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGCGCCCGCCGGGGGCTGCTGCGGCTGCCGCGCCGCTCGCTGCTCGCCGCGCTCTTCTTCTTTTCTCTCTCGTCCTCGCTGCTGTACTTCGTCTATGTGGCGCCCGGCATAGTGAACACCTACCTCTTCATGATGCAAGCCCAAGGCATTCTGATCCGGGACAACGTGAGAACAATCGGTGCTCAGGTTTATGAGCAGGTGCTTCGGAGTGCTTATGCCAAGAGGAACAGCAGTGTAAATGACTCAGATTATCCTCTTGACTTGAACCACAGTGAAACCTTCCTGCAAACTACAACATTTCTTCCTGAAGACTTCACCTACTTTGCAAACCATACCTGCCCTGAAAGACTCCCTTCCATGAAGGGCCCAATAGACATAAACATGAGTGAAATTGGAATGGATTACATTCATGAACTCTTCTCCAAAGACCCAACCATCAAGCTCGGAGGTCACTGGAAGCCTTCTGATTGCATGCCTCGGTGGAAGGTGGCGATCCTTATCCCCTTCCGGAACCGCCACGAGCACCTCCCAGTCCTGTTCAGACACCTGCTTCCCATGCTCCAGCGCCAGCGCTTGCAGTTTGCATTTTATGTGGTTGAACAAGTTGGTACCCAACCCTTTAATCGAGCCATGCTTTTCAACGTTGGCTTTCAAGAGGCAATGAAAGACTTGGATTGGGACTGTTTGATTTTTCATGATGTAGATCACATACCGGAAAGTGATCGCAACTATTATGGATGTGGACAGATGCCGAGGCATTTTGCAACCAAATTGGATAAGTATATGTATCTGCTTCCTTATACCGAGTTCTTTGGCGGAGTGAGTGGCTTAACAGTGGAACAATTTCGGAAAATCAATGGCTTTCCTAATGCTTTCTGGGGTTGGGGTGGAGAAGATGACGACCTCTGGAACAGAGTACAGAATGCAGGCTATTCTGTGAGCCGGCCAGAGGGTGACACAGGAAAGTACAAGTCCATTCCTCATCACCATCGAGGAGAAGTCCAGTTTCTTGGAAGGTATGCTCTGCTGAGGAAGTCAAAAGAACGGCAAGGGCTGGATGGCCTCAACAACCTGAACTACTTTGCAAACATCACATACGACGCCTTGTATAAAAACATAACTGTCAACCTGACACCCGAGCTGGCTCAGGTGAACGAGTACTGA
ORF Protein Sequence MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMMQAQGILIRDNVRTIGAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMPRWKVAILIPFRNRHEHLPVLFRHLLPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLNYFANITYDALYKNITVNLTPELAQVNEY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0042-Ab Anti-B4GT5/ B4GALT5/ B4Gal-T5 functional antibody
    Target Antigen GM-Tg-g-SE0042-Ag B4GALT5 protein
    ORF Viral Vector pGMLP001915 Human B4GALT5 Lentivirus plasmid
    ORF Viral Vector vGMLP001915 Human B4GALT5 Lentivirus particle


    Target information

    Target ID GM-SE0042
    Target Name B4GALT5
    Gene ID 9334, 56336, 713891, 362275, 101081792, 485920, 282407, 100071419
    Gene Symbol and Synonyms 9430078I07Rik,B4Gal-T5,B4GALT5,BETA4-GALT-IV,beta4Gal-T5,beta4GalT-V,gt-V
    Uniprot Accession O43286
    Uniprot Entry Name B4GT5_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000158470
    Target Classification Not Available

    This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The function of the enzyme encoded by this gene is not clear. This gene was previously designated as B4GALT4 but was renamed to B4GALT5. In the literature it is also referred to as beta4GalT2. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.