Human PSMB10/beta2i/LMP10 ORF/cDNA clone-Lentivirus particle (NM_002801.3)

Cat. No.: vGMLP001991

Pre-made Human PSMB10/beta2i/LMP10 Lentiviral expression plasmid for PSMB10 lentivirus packaging, PSMB10 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PS beta-10/PSMB10/beta2i products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001991 Human PSMB10 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001991
Gene Name PSMB10
Accession Number NM_002801.3
Gene ID 5699
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 822 bp
Gene Alias beta2i,LMP10,MECL1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGAAGCCAGCCCTGGAGCCCCGAGGGGGCTTCTCCTTCGAGAACTGCCAAAGAAATGCATCATTGGAACGCGTCCTCCCGGGGCTCAAGGTCCCTCACGCACGCAAGACCGGGACCACCATCGCGGGCCTGGTGTTCCAAGACGGGGTCATTCTGGGCGCCGATACGCGAGCCACTAACGATTCGGTCGTGGCGGACAAGAGCTGCGAGAAGATCCACTTCATCGCCCCCAAAATCTACTGCTGTGGGGCTGGAGTAGCCGCGGACGCCGAGATGACCACACGGATGGTGGCGTCCAAGATGGAGCTACACGCGTTATCTACGGGCCGCGAGCCCCGCGTGGCCACGGTCACTCGCATCCTGCGCCAGACGCTCTTCAGGTACCAGGGCCACGTGGGTGCATCGCTGATCGTGGGCGGCGTAGACCTGACTGGACCGCAGCTCTACGGTGTGCATCCCCATGGCTCCTACAGCCGTCTGCCCTTCACAGCCCTGGGCTCTGGTCAGGACGCGGCCCTGGCGGTGCTAGAAGACCGGTTCCAGCCGAACATGACGCTGGAGGCTGCTCAGGGGCTGCTGGTGGAAGCCGTCACCGCCGGGATCTTGGGTGACCTGGGCTCCGGGGGCAATGTGGACGCATGTGTGATCACAAAGACTGGCGCCAAGCTGCTGCGGACACTGAGCTCACCCACAGAGCCCGTGAAGAGGTCTGGCCGCTACCACTTTGTGCCTGGAACCACAGCTGTCCTGACCCAGACAGTGAAGCCACTAACCCTGGAGCTAGTGGAGGAAACTGTGCAGGCTATGGAGGTGGAGTAA
ORF Protein Sequence MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T09022-Ab Anti-PS beta-10 monoclonal antibody
    Target Antigen GM-Tg-g-T09022-Ag PS beta-10/PSMB10 protein
    ORF Viral Vector pGMLP001991 Human PSMB10 Lentivirus plasmid
    ORF Viral Vector vGMLP001991 Human PSMB10 Lentivirus particle


    Target information

    Target ID GM-T09022
    Target Name PS beta-10
    Gene ID 5699, 19171, 701088, 291983, 101082199, 489749, 282328, 100066381
    Gene Symbol and Synonyms beta2i,LMP10,Mecl-1,MECL1,PRAAS5,PSMB10
    Uniprot Accession P40306
    Uniprot Entry Name PSB10_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000205220
    Target Classification Not Available

    The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Proteolytic processing is required to generate a mature subunit. Expression of this gene is induced by gamma interferon, and this gene product replaces catalytic subunit 2 (proteasome beta 7 subunit) in the immunoproteasome. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.