Human CSN2/CASB ORF/cDNA clone-Lentivirus particle (NM_001891)
Cat. No.: vGMLP002067
Pre-made Human CSN2/CASB Lentiviral expression plasmid for CSN2 lentivirus packaging, CSN2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CSN2/CASB products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP002067 | Human CSN2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP002067 |
| Gene Name | CSN2 |
| Accession Number | NM_001891 |
| Gene ID | 1447 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 681 bp |
| Gene Alias | CASB |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAAGGTCCTCATCCTCGCCTGCCTGGTGGCTCTTGCTCTTGCAAGGGAGACCATAGAAAGCCTTTCAAGCAGTGAGGAATCTATTACAGAATACAAGCAGAAAGTTGAGAAGGTTAAACATGAGGACCAGCAGCAAGGAGAGGATGAACACCAGGATAAAATCTACCCCTCTTTCCAGCCACAGCCTCTGATCTATCCATTCGTTGAACCTATCCCCTATGGTTTTCTTCCACAAAACATTCTGCCTCTTGCTCAGCCTGCTGTGGTGCTGCCTGTCCCTCAGCCTGAAATAATGGAAGTCCCTAAAGCTAAAGACACTGTCTACACTAAGGGCAGAGTGATGCCTGTCCTTAAATCTCCAACGATACCCTTTTTTGACCCTCAAATCCCAAAACTCACTGATCTTGAAAATCTGCATCTTCCTCTGCCTCTGCTCCAGCCCTTGATGCAGCAGGTCCCTCAGCCTATTCCTCAGACTCTTGCACTTCCCCCTCAGCCCCTGTGGTCTGTTCCTCAGCCCAAAGTCCTGCCTATCCCCCAGCAAGTGGTGCCCTACCCTCAGAGAGCTGTGCCTGTTCAAGCCCTTCTGCTCAACCAAGAACTTCTACTTAACCCCACCCACCAGATCTACCCTGTGACTCAGCCACTTGCCCCAGTTCATAACCCCATTAGTGTCTAA |
| ORF Protein Sequence | MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0830-Ab | Anti-CASB/ CSN2 functional antibody |
| Target Antigen | GM-Tg-g-SE0830-Ag | CSN2 protein |
| ORF Viral Vector | pGMLP002067 | Human CSN2 Lentivirus plasmid |
| ORF Viral Vector | vGMLP002067 | Human CSN2 Lentivirus particle |
Target information
| Target ID | GM-SE0830 |
| Target Name | CSN2 |
| Gene ID | 1447, 12991, 707520, 29173, 101098299, 403644, 281099, 100033903 |
| Gene Symbol and Synonyms | CASB,CSN2,Csnb,PDC213 |
| Uniprot Accession | P05814 |
| Uniprot Entry Name | CASB_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000135222 |
| Target Classification | Not Available |
This gene is a member of the beta casein family. There are two types of casein protein, beta (encoded by this gene) and kappa, both of which are secreted in human milk. Beta casein is the principal protein in human milk and the primary source of essential amino acids for a suckling infant. Beta and kappa casein proteins acting together form spherical micelles which bind within them important dietary minerals, such as calcium and phosphorous. In addition, the C-terminal 14 aa of the protein has antimicrobial activity, especially in preterm milk, displaying antibacterial activity against S. aureus and Y. enterocolitica. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2020]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


