Human SCGN/CALBL/DJ501N12.8 ORF/cDNA clone-Lentivirus particle (NM_006998)
Cat. No.: vGMLP002186
Pre-made Human SCGN/CALBL/DJ501N12.8 Lentiviral expression plasmid for SCGN lentivirus packaging, SCGN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
SCGN/CALBL products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP002186 | Human SCGN Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP002186 |
Gene Name | SCGN |
Accession Number | NM_006998 |
Gene ID | 10590 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 831 bp |
Gene Alias | CALBL,DJ501N12.8,SECRET,SEGN,setagin |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGACAGCTCCCGGGAACCGACTCTGGGGCGCTTGGACGCCGCTGGCTTCTGGCAGGTCTGGCAGCGCTTTGATGCGGATGAAAAAGGTTACATAGAAGAGAAGGAACTCGATGCTTTCTTTCTCCACATGTTGATGAAACTGGGTACTGATGACACGGTCATGAAAGCAAATTTGCACAAGGTGAAACAGCAGTTTATGACTACCCAAGATGCCTCTAAAGATGGTCGCATTCGGATGAAAGAGCTTGCTGGTATGTTCTTATCTGAGGATGAAAACTTTCTTCTGCTCTTTCGCCGGGAAAACCCACTGGACAGCAGCGTGGAGTTTATGCAGATTTGGCGCAAATATGACGCTGACAGCAGTGGCTTTATATCAGCTGCTGAGCTCCGCAACTTCCTCCGAGACCTCTTTCTTCACCACAAAAAGGCCATTTCTGAGGCTAAACTGGAAGAATACACTGGCACCATGATGAAGATTTTTGACAGAAATAAAGATGGTCGGTTGGATCTAAATGACTTAGCAAGGATTCTGGCTCTTCAGGAAAACTTCCTTCTCCAATTTAAAATGGATGCTTGTTCTACTGAAGAAAGGAAAAGGGACTTTGAGAAAATCTTTGCCTACTATGATGTTAGTAAAACAGGAGCCCTGGAAGGCCCAGAAGTGGATGGGTTTGTCAAAGACATGATGGAGCTTGTCCAGCCCAGCATCAGCGGGGTGGACCTTGATAAGTTCCGCGAGATTCTCCTGCGTCACTGCGACGTGAACAAGGATGGAAAAATTCAGAAGTCTGAGCTGGCTTTGTGTCTTGGGCTGAAAATCAACCCATAA |
ORF Protein Sequence | MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE1422-Ab | Anti-SEGN/ SCGN/ CALBL functional antibody |
Target Antigen | GM-Tg-g-SE1422-Ag | SCGN protein |
ORF Viral Vector | pGMLP002186 | Human SCGN Lentivirus plasmid |
ORF Viral Vector | vGMLP002186 | Human SCGN Lentivirus particle |
Target information
Target ID | GM-SE1422 |
Target Name | SCGN |
Gene ID | 10590, 214189, 694072, 306942, 101097064, 610954, 618206, 100067986 |
Gene Symbol and Synonyms | CALBL,DJ501N12.8,SCGN,SECRET,SEGN,setagin |
Uniprot Accession | O76038 |
Uniprot Entry Name | SEGN_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000079689 |
Target Classification | Not Available |
The encoded protein is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.