Human GRP/BN/GRP-10 ORF/cDNA clone-Lentivirus particle (NM_002091)
Cat. No.: vGMLP002238
Pre-made Human GRP/BN/GRP-10 Lentiviral expression plasmid for GRP lentivirus packaging, GRP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
GRP/BN products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP002238 | Human GRP Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP002238 |
| Gene Name | GRP |
| Accession Number | NM_002091 |
| Gene ID | 2922 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 447 bp |
| Gene Alias | BN,GRP-10,preproGRP,proGRP |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCGCGGCCGTGAGCTCCCGCTGGTCCTGCTGGCGCTGGTCCTCTGCCTGGCGCCCCGGGGGCGAGCGGTCCCGCTGCCTGCGGGCGGAGGGACCGTGCTGACCAAGATGTACCCGCGCGGCAACCACTGGGCGGTGGGGCACTTAATGGGGAAAAAGAGCACAGGGGAGTCTTCTTCTGTTTCTGAGAGAGGGAGCCTGAAGCAGCAGCTGAGAGAGTACATCAGGTGGGAAGAAGCTGCAAGGAATTTGCTGGGTCTCATAGAAGCAAAGGAGAACAGAAACCACCAGCCACCTCAACCCAAGGCCCTGGGCAATCAGCAGCCTTCGTGGGATTCAGAGGATAGCAGCAACTTCAAAGATGTAGGTTCAAAAGGCAAAGTTGGTAGACTCTCTGCTCCAGGTTCTCAACGTGAAGGAAGGAACCCCCAGCTGAACCAGCAATGA |
| ORF Protein Sequence | MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0960-Ab | Anti-GRP/ BN-10/ preproGRP functional antibody |
| Target Antigen | GM-Tg-g-SE0960-Ag | GRP protein |
| ORF Viral Vector | pGMLP002238 | Human GRP Lentivirus plasmid |
| ORF Viral Vector | vGMLP002238 | Human GRP Lentivirus particle |
Target information
| Target ID | GM-SE0960 |
| Target Name | GRP |
| Gene ID | 2922, 225642, 696983, 171101, 109493482, 610154, 615323, 100050124 |
| Gene Symbol and Synonyms | BLP,BN,GRP,GRP-10,preproGRP,proGRP |
| Uniprot Accession | P07492 |
| Uniprot Entry Name | GRP_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Diagnostics Biomarker |
| Disease | Not Available |
| Gene Ensembl | ENSG00000134443 |
| Target Classification | Not Available |
This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. The encoded preproprotein is proteolytically processed to generate two peptides, gastrin-releasing peptide and neuromedin-C. These peptides regulate numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation. These peptides are also likely to play a role in human cancers of the lung, colon, stomach, pancreas, breast, and prostate. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


