Human RCVRN/RCV1 ORF/cDNA clone-Lentivirus particle (NM_002903)

Cat. No.: vGMLP002352

Pre-made Human RCVRN/RCV1 Lentiviral expression plasmid for RCVRN lentivirus packaging, RCVRN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RCVRN/RCV1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002352 Human RCVRN Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002352
Gene Name RCVRN
Accession Number NM_002903
Gene ID 5957
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 603 bp
Gene Alias RCV1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGAACAGCAAAAGTGGGGCCCTGTCCAAGGAGATCCTGGAGGAGCTGCAGCTGAACACCAAGTTCTCGGAGGAGGAGCTGTGCTCCTGGTACCAGTCCTTCCTGAAGGACTGTCCCACCGGCCGCATCACCCAGCAGCAGTTCCAGAGCATCTACGCCAAGTTCTTCCCCGACACCGACCCCAAGGCCTACGCCCAGCATGTGTTCCGCAGCTTCGATTCCAACCTCGACGGCACCCTGGACTTCAAGGAGTACGTCATCGCCCTGCACATGACCACCGCGGGCAAGACCAACCAGAAGCTGGAGTGGGCCTTCTCCCTCTACGACGTGGACGGTAACGGGACCATCAGCAAGAATGAAGTGCTGGAGATCGTCATGGCTATTTTCAAAATGATCACTCCCGAGGACGTGAAGCTCCTTCCAGACGATGAAAACACGCCGGAAAAGCGAGCCGAGAAGATCTGGAAGTACTTTGGAAAGAATGATGATGATAAACTTACAGAGAAAGAATTCATTGAGGGGACACTGGCCAATAAGGAAATTCTGCGACTGATCCAGTTTGAGCCTCAAAAAGTGAAGGAAAAGATGAAGAACGCCTGA
ORF Protein Sequence MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T76894-Ab Anti-RCVRN monoclonal antibody
    Target Antigen GM-Tg-g-T76894-Ag RCVRN protein
    ORF Viral Vector pGMLP002352 Human RCVRN Lentivirus plasmid
    ORF Viral Vector vGMLP002352 Human RCVRN Lentivirus particle


    Target information

    Target ID GM-T76894
    Target Name RCVRN
    Gene ID 5957, 19674, 717807, 140936, 101084400, 489500, 281447, 100073079
    Gene Symbol and Synonyms CAR,RCV1,RCVRN,S-modulin
    Uniprot Accession P35243
    Uniprot Entry Name RECO_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000109047
    Target Classification Not Available

    This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.