Human TM2D1/BBP ORF/cDNA clone-Lentivirus particle (NM_032027)

Cat. No.: vGMLP002530

Pre-made Human TM2D1/BBP Lentiviral expression plasmid for TM2D1 lentivirus packaging, TM2D1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TM2D1/BBP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002530 Human TM2D1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002530
Gene Name TM2D1
Accession Number NM_032027
Gene ID 83941
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 624 bp
Gene Alias BBP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCCGCCTGGCCGTCTGGTCCGTCTGCTCCGGAGGCCGTGACGGCCAGACTCGTTGGTGTCCTGTGGTTCGTCTCAGTCACTACAGGACCCTGGGGGGCTGTTGCCACCTCCGCCGGGGGCGAGGAGTCGCTTAAGTGCGAGGACCTCAAAGTGGGACAATATATTTGTAAAGATCCAAAAATAAATGACGCTACGCAAGAACCAGTTAACTGTACAAACTACACAGCTCATGTTTCCTGTTTTCCAGCACCCAACATAACTTGTAAGGATTCCAGTGGCAATGAAACACATTTTACTGGGAACGAAGTTGGTTTTTTCAAGCCCATATCTTGCCGAAATGTAAATGGCTATTCCTACAAAGTGGCAGTCGCATTGTCTCTTTTTCTTGGATGGTTGGGAGCAGATCGATTTTACCTTGGATACCCTGCTTTGGGTTTGTTAAAGTTTTGCACTGTAGGGTTTTGTGGAATTGGGAGCCTAATTGATTTCATTCTTATTTCAATGCAGATTGTTGGACCTTCAGATGGAAGTAGTTACATTATAGATTACTATGGAACCAGACTTACAAGACTGAGTATTACTAATGAAACATTTAGAAAAACGCAATTATATCCATAA
ORF Protein Sequence MAAAWPSGPSAPEAVTARLVGVLWFVSVTTGPWGAVATSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFCGIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1919-Ab Anti-TM2D1 monoclonal antibody
    Target Antigen GM-Tg-g-IP1919-Ag TM2D1 protein
    ORF Viral Vector pGMLP002530 Human TM2D1 Lentivirus plasmid
    ORF Viral Vector vGMLP002530 Human TM2D1 Lentivirus particle


    Target information

    Target ID GM-IP1919
    Target Name TM2D1
    Gene ID 83941, 94043, 694282, 362545, 101080393, 479551, 514249, 100070493
    Gene Symbol and Synonyms 2310026L18Rik,BBP,TM2D1
    Uniprot Accession Q9BX74
    Uniprot Entry Name TM2D1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000162604
    Target Classification Not Available

    The protein encoded by this gene is a beta-amyloid peptide-binding protein. It contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily and known to be important in heterotrimeric G protein activation. Beta-amyloid peptide has been established to be a causative factor in neuron death and the consequent diminution of cognitive abilities observed in Alzheimer's disease. This protein may be a target of neurotoxic beta-amyloid peptide, and may mediate cellular vulnerability to beta-amyloid peptide toxicity through a G protein-regulated program of cell death. Several transcript variants have been found for this gene. [provided by RefSeq, Feb 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.