Human TM2D1/BBP ORF/cDNA clone-Lentivirus particle (NM_032027)
Cat. No.: vGMLP002530
Pre-made Human TM2D1/BBP Lentiviral expression plasmid for TM2D1 lentivirus packaging, TM2D1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
TM2D1/BBP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP002530 | Human TM2D1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP002530 |
| Gene Name | TM2D1 |
| Accession Number | NM_032027 |
| Gene ID | 83941 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 624 bp |
| Gene Alias | BBP |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCGGCCGCCTGGCCGTCTGGTCCGTCTGCTCCGGAGGCCGTGACGGCCAGACTCGTTGGTGTCCTGTGGTTCGTCTCAGTCACTACAGGACCCTGGGGGGCTGTTGCCACCTCCGCCGGGGGCGAGGAGTCGCTTAAGTGCGAGGACCTCAAAGTGGGACAATATATTTGTAAAGATCCAAAAATAAATGACGCTACGCAAGAACCAGTTAACTGTACAAACTACACAGCTCATGTTTCCTGTTTTCCAGCACCCAACATAACTTGTAAGGATTCCAGTGGCAATGAAACACATTTTACTGGGAACGAAGTTGGTTTTTTCAAGCCCATATCTTGCCGAAATGTAAATGGCTATTCCTACAAAGTGGCAGTCGCATTGTCTCTTTTTCTTGGATGGTTGGGAGCAGATCGATTTTACCTTGGATACCCTGCTTTGGGTTTGTTAAAGTTTTGCACTGTAGGGTTTTGTGGAATTGGGAGCCTAATTGATTTCATTCTTATTTCAATGCAGATTGTTGGACCTTCAGATGGAAGTAGTTACATTATAGATTACTATGGAACCAGACTTACAAGACTGAGTATTACTAATGAAACATTTAGAAAAACGCAATTATATCCATAA |
| ORF Protein Sequence | MAAAWPSGPSAPEAVTARLVGVLWFVSVTTGPWGAVATSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFCGIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP1919-Ab | Anti-TM2D1 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP1919-Ag | TM2D1 protein |
| ORF Viral Vector | pGMLP002530 | Human TM2D1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP002530 | Human TM2D1 Lentivirus particle |
Target information
| Target ID | GM-IP1919 |
| Target Name | TM2D1 |
| Gene ID | 83941, 94043, 694282, 362545, 101080393, 479551, 514249, 100070493 |
| Gene Symbol and Synonyms | 2310026L18Rik,BBP,TM2D1 |
| Uniprot Accession | Q9BX74 |
| Uniprot Entry Name | TM2D1_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000162604 |
| Target Classification | Not Available |
The protein encoded by this gene is a beta-amyloid peptide-binding protein. It contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily and known to be important in heterotrimeric G protein activation. Beta-amyloid peptide has been established to be a causative factor in neuron death and the consequent diminution of cognitive abilities observed in Alzheimer's disease. This protein may be a target of neurotoxic beta-amyloid peptide, and may mediate cellular vulnerability to beta-amyloid peptide toxicity through a G protein-regulated program of cell death. Several transcript variants have been found for this gene. [provided by RefSeq, Feb 2016]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


