Human PPIC/CYPC ORF/cDNA clone-Lentivirus particle (NM_000943)

Cat. No.: vGMLP002533

Pre-made Human PPIC/CYPC Lentiviral expression plasmid for PPIC lentivirus packaging, PPIC lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PPIC/CYPC products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002533 Human PPIC Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002533
Gene Name PPIC
Accession Number NM_000943
Gene ID 5480
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 639 bp
Gene Alias CYPC
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCCCGGGTCCTCGGCTGCTGCTACCTCTCGTGCTTTGCGTGGGGCTCGGCGCACTTGTGTTTTCTTCGGGGGCCGAGGGCTTCCGCAAGCGAGGCCCCTCGGTGACGGCCAAGGTCTTCTTTGATGTGAGGATTGGAGACAAAGATGTTGGCAGAATTGTGATTGGCCTCTTTGGAAAAGTTGTGCCCAAGACAGTGGAAAATTTTGTTGCTCTAGCAACAGGAGAGAAAGGATATGGATATAAAGGAAGCAAGTTTCATCGTGTCATCAAGGATTTCATGATTCAAGGAGGTGACATCACCACTGGAGATGGCACTGGGGGTGTGAGCATCTATGGTGAGACATTTCCAGATGAGAACTTCAAGCTGAAGCACTATGGCATTGGGTGGGTCAGCATGGCCAACGCTGGGCCTGACACCAATGGCTCTCAGTTCTTTATCACCTTGACCAAGCCCACCTGGTTGGACGGCAAACATGTGGTGTTTGGAAAAGTCATTGATGGGATGACAGTGGTGCACTCCATAGAGCTCCAAGCAACTGATGGGCATGACCGTCCACTCACCAACTGCTCGATCATCAACAGTGGCAAGATAGACGTGAAAACGCCTTTTGTGGTTGAGATCGCTGATTGGTGA
ORF Protein Sequence MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIADW

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0422-Ab Anti-PPIC/ CYPC functional antibody
    Target Antigen GM-Tg-g-SE0422-Ag PPIC protein
    ORF Viral Vector pGMLP002533 Human PPIC Lentivirus plasmid
    ORF Viral Vector vGMLP002533 Human PPIC Lentivirus particle


    Target information

    Target ID GM-SE0422
    Target Name PPIC
    Gene ID 5480, 19038, 700998, 291463, 111560570, 481480, 535494, 100073095
    Gene Symbol and Synonyms CyP-20c,CYPC,PPIC
    Uniprot Accession P45877
    Uniprot Entry Name PPIC_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000168938
    Target Classification Not Available

    The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase)) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. Similar to other PPIases, this protein can bind immunosuppressant cyclosporin A. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.