Human TMEM14A/C6orf73/PTD011 ORF/cDNA clone-Lentivirus particle (NM_014051)

Cat. No.: vGMLP002573

Pre-made Human TMEM14A/C6orf73/PTD011 Lentiviral expression plasmid for TMEM14A lentivirus packaging, TMEM14A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TMEM14A/C6orf73 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002573 Human TMEM14A Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002573
Gene Name TMEM14A
Accession Number NM_014051
Gene ID 28978
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 300 bp
Gene Alias C6orf73,PTD011
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACCTGATCGGTTTTGGTTATGCAGCCCTCGTGACATTTGGAAGCATTTTTGGATATAAGCGGAGAGGTGGTGTTCCGTCTTTGATTGCTGGTCTTTTTGTTGGATGTTTGGCCGGCTATGGAGCTTACCGTGTCTCCAATGACAAACGAGATGTAAAAGTGTCACTGTTTACAGCTTTCTTCCTGGCTACCATAATGGGTGTGAGATTTAAGAGGTCCAAGAAAATAATGCCTGCTGGTTTGGTTGCAGGTTTAAGCCTCATGATGATCCTGAGACTTGTCTTGTTGCTGCTCTGA
ORF Protein Sequence MDLIGFGYAALVTFGSIFGYKRRGGVPSLIAGLFVGCLAGYGAYRVSNDKRDVKVSLFTAFFLATIMGVRFKRSKKIMPAGLVAGLSLMMILRLVLLLL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1989-Ab Anti-TMEM14A monoclonal antibody
    Target Antigen GM-Tg-g-IP1989-Ag TMEM14A protein
    ORF Viral Vector pGMLP002573 Human TMEM14A Lentivirus plasmid
    ORF Viral Vector vGMLP002573 Human TMEM14A Lentivirus particle


    Target information

    Target ID GM-IP1989
    Target Name TMEM14A
    Gene ID 28978, 75712, 708829, 363206, 101084541, 474937, 510383, 100630848
    Gene Symbol and Synonyms 5730496E24Rik,C6orf73,PTD011,TMEM14A
    Uniprot Accession Q9Y6G1
    Uniprot Entry Name TM14A_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000096092
    Target Classification Not Available

    Involved in negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway. Located in endoplasmic reticulum membrane and mitochondrial membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.