Human TOMM22/1C9-2/MST065 ORF/cDNA clone-Lentivirus particle (NM_020243)

Cat. No.: vGMLP002592

Pre-made Human TOMM22/1C9-2/MST065 Lentiviral expression plasmid for TOMM22 lentivirus packaging, TOMM22 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TOMM22/1C9-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002592 Human TOMM22 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002592
Gene Name TOMM22
Accession Number NM_020243
Gene ID 56993
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 429 bp
Gene Alias 1C9-2,MST065,MSTP065,TOM22
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGCCGCCGTCGCTGCTGCCGGTGCAGGGGAACCCCAGTCCCCGGACGAATTGCTCCCGAAAGGCGACGCGGAGAAGCCTGAGGAGGAGCTGGAGGAGGACGACGATGAGGAGCTAGATGAGACCCTGTCGGAGAGACTATGGGGCCTGACGGAGATGTTTCCGGAGAGGGTCCGGTCCGCGGCCGGAGCCACTTTTGATCTTTCCCTCTTTGTGGCTCAGAAAATGTACAGGTTTTCCAGGGCAGCCTTGTGGATTGGGACCACTTCCTTTATGATCCTGGTTCTTCCCGTTGTCTTTGAGACGGAGAAGTTGCAAATGGAGCAACAGCAGCAACTGCAGCAGCGGCAGATACTTCTAGGACCTAACACAGGGCTCTCAGGAGGAATGCCAGGGGCTCTACCCTCACTTCCTGGAAAGATCTAG
ORF Protein Sequence MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2160-Ab Anti-TOMM22 monoclonal antibody
    Target Antigen GM-Tg-g-IP2160-Ag TOMM22 protein
    ORF Viral Vector pGMLP002592 Human TOMM22 Lentivirus plasmid
    ORF Viral Vector vGMLP002592 Human TOMM22 Lentivirus particle


    Target information

    Target ID GM-IP2160
    Target Name TOMM22
    Gene ID 56993, 223696, 701286, 300075, 101081394, 610117, 510780, 100070131
    Gene Symbol and Synonyms 1C9-2,2310047D01,MST065,MSTP065,rTOM22,TOM22,TOMM22
    Uniprot Accession Q9NS69
    Uniprot Entry Name TOM22_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000100216
    Target Classification Not Available

    The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.