Human RAB22A ORF/cDNA clone-Lentivirus particle (NM_020673)

Cat. No.: vGMLP002606

Pre-made Human RAB22A/ Lentiviral expression plasmid for RAB22A lentivirus packaging, RAB22A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to Rab22a/RAB22A/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002606 Human RAB22A Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002606
Gene Name RAB22A
Accession Number NM_020673
Gene ID 57403
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 585 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGCTGAGGGAGCTCAAAGTGTGTCTGCTCGGGGATACAGGTGTAGGTAAATCGAGTATTGTGTGGCGGTTTGTGGAAGACAGTTTTGATCCAAACATCAACCCAACAATAGGGGCATCTTTTATGACCAAGACTGTCCAGTACCAAAATGAGCTACATAAATTCCTAATCTGGGATACAGCTGGACAAGAACGATTTCGTGCCTTAGCACCAATGTACTATCGAGGGTCGGCTGCAGCTATAATCGTTTATGATATCACAAAAGAAGAGACATTTTCAACATTAAAGAATTGGGTGAAAGAGCTTCGACAGCATGGCCCACCTAATATTGTAGTTGCCATTGCAGGAAATAAATGTGATCTTATCGATGTAAGAGAAGTCATGGAGAGAGATGCAAAGGACTACGCCGACTCTATTCATGCAATTTTTGTAGAGACCAGCGCAAAAAACGCGATAAACATAAATGAACTCTTTATAGAAATTAGTCGAAGAATTCCATCCACTGACGCCAACCTGCCATCTGGCGGTAAGGGCTTCAAACTCCGAAGACAGCCTTCAGAGCCAAAGCGGAGCTGCTGCTGA
ORF Protein Sequence MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T82955-Ab Anti-Rab22a monoclonal antibody
    Target Antigen GM-Tg-g-T82955-Ag Rab22a/RAB22A protein
    ORF Viral Vector pGMLP002606 Human RAB22A Lentivirus plasmid
    ORF Viral Vector vGMLP002606 Human RAB22A Lentivirus particle


    Target information

    Target ID GM-T82955
    Target Name Rab22a
    Gene ID 57403, 19334, 699283, 366265, 101092426, 403864, 617385, 100056212
    Gene Symbol and Synonyms 3732413A17Rik,E130120E14Rik,Rab22,RAB22A
    Uniprot Accession Q9UL26
    Uniprot Entry Name RB22A_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000124209
    Target Classification Not Available

    The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosomal compartments. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.