Human TMED9/GMP25/HSGP25L2G ORF/cDNA clone-Lentivirus particle (NM_017510)

Cat. No.: vGMLP002649

Pre-made Human TMED9/GMP25/HSGP25L2G Lentiviral expression plasmid for TMED9 lentivirus packaging, TMED9 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TMED9/GMP25 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002649 Human TMED9 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002649
Gene Name TMED9
Accession Number NM_017510
Gene ID 54732
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 708 bp
Gene Alias GMP25,HSGP25L2G,p24a2,p24alpha2,p25
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGTGGAGCTGGGCGTGCTGCTCGTCCGGCCCCGGCCCGGAACCGGGCTGGGTAGAGTGATGCGGACCCTCCTGCTGGTGCTGTGGCTGGCGACGCGCGGAAGCGCGCTCTACTTTCACATCGGAGAGACGGAGAAGAAGTGCTTTATTGAGGAGATCCCGGACGAGACCATGGTCATAGGAAACTACCGGACGCAGCTGTATGACAAGCAGCGGGAGGAGTACCAGCCGGCCACCCCGGGGCTTGGCATGTTTGTGGAGGTGAAGGACCCAGAGGACAAGGTCATCCTGGCCCGGCAGTATGGCTCCGAGGGCAGGTTCACTTTCACTTCCCATACCCCTGGTGAGCACCAGATCTGTCTTCACTCCAATTCCACCAAGTTCTCCCTCTTTGCTGGAGGCATGCTGAGAGTTCACCTGGACATCCAGGTAGGTGAACATGCCAATGACTATGCAGAAATTGCTGCTAAAGACAAGTTGAGTGAGTTGCAGCTACGAGTGCGACAGCTGGTGGAACAAGTGGAGCAGATCCAGAAAGAGCAGAACTACCAGCGGTGGCGAGAGGAGCGCTTCCGGCAGACCAGTGAGAGCACCAACCAGCGGGTGCTGTGGTGGTCCATTCTGCAGACCCTCATCCTCGTGGCCATCGGTGTCTGGCAGATGCGGCACCTCAAGAGCTTCTTTGAAGCCAAGAAGCTTGTGTAG
ORF Protein Sequence MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1952-Ab Anti-TMED9 monoclonal antibody
    Target Antigen GM-Tg-g-IP1952-Ag TMED9 protein
    ORF Viral Vector pGMLP002649 Human TMED9 Lentivirus plasmid
    ORF Viral Vector vGMLP002649 Human TMED9 Lentivirus particle


    Target information

    Target ID GM-IP1952
    Target Name TMED9
    Gene ID 54732, 67511, 701114, 361207, 101088905, 481444, 100068443
    Gene Symbol and Synonyms 2400003B06Rik,GMP25,HSGP25L2G,p24a2,p24alpha2,p25,RGD1307627,TMED9
    Uniprot Accession Q9BVK6
    Uniprot Entry Name TMED9_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000184840
    Target Classification Not Available

    This gene is a member of a family of genes encoding transport proteins located in the endoplasmic reticulum and the Golgi. A similar gene in mouse is the target of microRNA miR-296, which is part of an imprinted cluster. [provided by RefSeq, Jul 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.