Human CTNNBIP1/ICAT ORF/cDNA clone-Lentivirus particle (NM_020248)

Cat. No.: vGMLP002667

Pre-made Human CTNNBIP1/ICAT Lentiviral expression plasmid for CTNNBIP1 lentivirus packaging, CTNNBIP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CTNNBIP1/ICAT products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002667 Human CTNNBIP1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002667
Gene Name CTNNBIP1
Accession Number NM_020248
Gene ID 56998
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 246 bp
Gene Alias ICAT
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACCGCGAGGGAGCTCCCGGGAAGAGTCCGGAGGAGATGTACATTCAGCAGAAGGTCCGAGTGCTGCTCATGCTGCGGAAGATGGGATCAAACCTGACAGCCAGCGAGGAGGAGTTCCTGCGCACCTATGCAGGGGTGGTCAACAGCCAGCTCAGCCAGCTGCCTCCGCACTCCATCGACCAGGGTGCAGAGGACGTGGTGATGGCGTTTTCCAGGTCGGAGACGGAAGACCGGAGGCAGTAG
ORF Protein Sequence MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2441-Ab Anti-CTNNBIP1 monoclonal antibody
    Target Antigen GM-Tg-g-IP2441-Ag CTNNBIP1 protein
    ORF Viral Vector pGMLP002667 Human CTNNBIP1 Lentivirus plasmid
    ORF Viral Vector vGMLP002667 Human CTNNBIP1 Lentivirus particle


    Target information

    Target ID GM-IP2441
    Target Name CTNNBIP1
    Gene ID 56998, 67087, 712257, 503000, 101094518, 614630, 100630146
    Gene Symbol and Synonyms 1110008O09Rik,2310001I19Rik,Catnbip1,CTNNBIP1,ICAT
    Uniprot Accession Q9NSA3
    Uniprot Entry Name CNBP1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000178585
    Target Classification Not Available

    The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.