Human RARRES3/HRASLS4/HRSL4 ORF/cDNA clone-Lentivirus particle (NM_004585)

Cat. No.: vGMLP002799

Pre-made Human RARRES3/HRASLS4/HRSL4 Lentiviral expression plasmid for RARRES3 lentivirus packaging, RARRES3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RARRES3/HRASLS4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002799 Human RARRES3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002799
Gene Name RARRES3
Accession Number NM_004585
Gene ID 5920
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 495 bp
Gene Alias HRASLS4,HRSL4,PLA1/2-3,RIG1,TIG3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTTCGCCACACCAAGAGCCCAAACCTGGAGACCTGATTGAGATTTTCCGCCTTGGCTATGAGCACTGGGCCCTGTATATAGGAGATGGCTACGTGATCCATCTGGCTCCTCCAAGTGAGTACCCCGGGGCTGGCTCCTCCAGTGTCTTCTCAGTCCTGAGCAACAGTGCAGAGGTGAAACGGGAGCGCCTGGAAGATGTGGTGGGAGGCTGTTGCTATCGGGTCAACAACAGCTTGGACCATGAGTACCAACCACGGCCCGTGGAGGTGATCATCAGTTCTGCGAAGGAGATGGTTGGTCAGAAGATGAAGTACAGTATTGTGAGCAGGAACTGTGAGCACTTTGTCACCCAGCTGAGATATGGCAAGTCCCGCTGTAAACAGGTGGAAAAGGCCAAGGTTGAAGTCGGTGTGGCCACGGCGCTTGGAATCCTGGTTGTTGCTGGATGCTCTTTTGCGATTAGGAGATACCAAAAAAAAGCGACAGCCTGA
ORF Protein Sequence MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1472-Ab Anti-RARRES3 monoclonal antibody
    Target Antigen GM-Tg-g-IP1472-Ag RARRES3 protein
    ORF Viral Vector pGMLP002799 Human RARRES3 Lentivirus plasmid
    ORF Viral Vector vGMLP002799 Human RARRES3 Lentivirus particle


    Target information

    Target ID GM-IP1472
    Target Name RARRES3
    Gene ID 5920, 722189, 483772
    Gene Symbol and Synonyms HRASLS4,HRSL4,PLA1/2-3,PLAAT-4,PLAAT4,RARRES3,RIG1,TIG3
    Uniprot Accession Q9UL19
    Uniprot Entry Name PLAT4_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000133321
    Target Classification Not Available

    Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES1, RARRES2, and RARRES3 are genes whose expression is upregulated by the synthetic retinoid tazarotene. RARRES3 is thought act as a tumor suppressor or growth regulator. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.