Human RARRES3/HRASLS4/HRSL4 ORF/cDNA clone-Lentivirus particle (NM_004585)
Cat. No.: vGMLP002799
Pre-made Human RARRES3/HRASLS4/HRSL4 Lentiviral expression plasmid for RARRES3 lentivirus packaging, RARRES3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
RARRES3/HRASLS4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP002799 | Human RARRES3 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP002799 |
| Gene Name | RARRES3 |
| Accession Number | NM_004585 |
| Gene ID | 5920 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 495 bp |
| Gene Alias | HRASLS4,HRSL4,PLA1/2-3,RIG1,TIG3 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCTTCGCCACACCAAGAGCCCAAACCTGGAGACCTGATTGAGATTTTCCGCCTTGGCTATGAGCACTGGGCCCTGTATATAGGAGATGGCTACGTGATCCATCTGGCTCCTCCAAGTGAGTACCCCGGGGCTGGCTCCTCCAGTGTCTTCTCAGTCCTGAGCAACAGTGCAGAGGTGAAACGGGAGCGCCTGGAAGATGTGGTGGGAGGCTGTTGCTATCGGGTCAACAACAGCTTGGACCATGAGTACCAACCACGGCCCGTGGAGGTGATCATCAGTTCTGCGAAGGAGATGGTTGGTCAGAAGATGAAGTACAGTATTGTGAGCAGGAACTGTGAGCACTTTGTCACCCAGCTGAGATATGGCAAGTCCCGCTGTAAACAGGTGGAAAAGGCCAAGGTTGAAGTCGGTGTGGCCACGGCGCTTGGAATCCTGGTTGTTGCTGGATGCTCTTTTGCGATTAGGAGATACCAAAAAAAAGCGACAGCCTGA |
| ORF Protein Sequence | MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP1472-Ab | Anti-RARRES3 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP1472-Ag | RARRES3 protein |
| ORF Viral Vector | pGMLP002799 | Human RARRES3 Lentivirus plasmid |
| ORF Viral Vector | vGMLP002799 | Human RARRES3 Lentivirus particle |
Target information
| Target ID | GM-IP1472 |
| Target Name | RARRES3 |
| Gene ID | 5920, 722189, 483772 |
| Gene Symbol and Synonyms | HRASLS4,HRSL4,PLA1/2-3,PLAAT-4,PLAAT4,RARRES3,RIG1,TIG3 |
| Uniprot Accession | Q9UL19 |
| Uniprot Entry Name | PLAT4_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000133321 |
| Target Classification | Not Available |
Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES1, RARRES2, and RARRES3 are genes whose expression is upregulated by the synthetic retinoid tazarotene. RARRES3 is thought act as a tumor suppressor or growth regulator. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


