Human AVP/ADH/ARVP ORF/cDNA clone-Lentivirus particle (NM_000490)
Cat. No.: vGMLP002893
Pre-made Human AVP/ADH/ARVP Lentiviral expression plasmid for AVP lentivirus packaging, AVP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
AVP/ADH products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP002893 | Human AVP Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP002893 |
Gene Name | AVP |
Accession Number | NM_000490 |
Gene ID | 551 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 495 bp |
Gene Alias | ADH,ARVP,AVP-NPII,AVRP,VP |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCCTGACACCATGCTGCCCGCCTGCTTCCTCGGCCTACTGGCCTTCTCCTCCGCGTGCTACTTCCAGAACTGCCCGAGGGGCGGCAAGAGGGCCATGTCCGACCTGGAGCTGAGACAGTGCCTCCCCTGCGGCCCCGGGGGCAAAGGCCGCTGCTTCGGGCCCAGCATCTGCTGCGCGGACGAGCTGGGCTGCTTCGTGGGCACGGCTGAGGCGCTGCGCTGCCAGGAGGAGAACTACCTGCCGTCGCCCTGCCAGTCCGGCCAGAAGGCGTGCGGGAGCGGGGGCCGCTGCGCCGCCTTCGGCGTTTGCTGCAACGACGAGAGCTGCGTGACCGAGCCCGAGTGCCGCGAGGGCTTTCACCGCCGCGCCCGCGCCAGCGACCGGAGCAACGCCACGCAGCTGGACGGGCCGGCCGGGGCCTTGCTGCTGCGGCTGGTGCAGCTGGCCGGGGCGCCCGAGCCCTTCGAGCCCGCCCAGCCCGACGCCTACTGA |
ORF Protein Sequence | MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRARASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T20975-Ab | Anti-NEU2/ AVP/ ADH functional antibody |
Target Antigen | GM-Tg-g-T20975-Ag | AVP protein |
ORF Viral Vector | pGMLP002893 | Human AVP Lentivirus plasmid |
ORF Viral Vector | vGMLP002893 | Human AVP Lentivirus particle |
Target information
Target ID | GM-T20975 |
Target Name | AVP |
Gene ID | 551, 11998, 717101, 24221, 101096305, 403579, 280728, 100066842 |
Gene Symbol and Synonyms | ADH,ARVP,AVP,AVP-NPII,AVRP,DI,Vas,VP,Vsp |
Uniprot Accession | P01185 |
Uniprot Entry Name | NEU2_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000101200 |
Target Classification | Not Available |
This gene encodes a member of the vasopressin/oxytocin family and preproprotein that is proteolytically processed to generate multiple protein products. These products include the neuropeptide hormone arginine vasopressin, and two other peptides, neurophysin 2 and copeptin. Arginine vasopressin is a posterior pituitary hormone that is synthesized in the supraoptic nucleus and paraventricular nucleus of the hypothalamus. Along with its carrier protein, neurophysin 2, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis where it is either stored or secreted into the bloodstream. The precursor is thought to be activated while it is being transported along the axon to the posterior pituitary. Arginine vasopressin acts as a growth factor by enhancing pH regulation through acid-base transport systems. It has a direct antidiuretic action on the kidney, and also causes vasoconstriction of the peripheral vessels. This hormone can contract smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions. Mutations in this gene cause autosomal dominant neurohypophyseal diabetes insipidus (ADNDI). This gene is present in a gene cluster with the related gene oxytocin on chromosome 20.
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.