Human TMEM38B/bA219P18.1/C9orf87 ORF/cDNA clone-Lentivirus particle (NM_018112)

Cat. No.: vGMLP003011

Pre-made Human TMEM38B/bA219P18.1/C9orf87 Lentiviral expression plasmid for TMEM38B lentivirus packaging, TMEM38B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TMEM38B/bA219P18.1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003011 Human TMEM38B Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003011
Gene Name TMEM38B
Accession Number NM_018112
Gene ID 55151
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 876 bp
Gene Alias bA219P18.1,C9orf87,D4Ertd89e,OI14,TRIC-B,TRICB
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGATTCTCCATGGGACGAGTTGGCTCTGGCCTTCTCCCGCACGTCCATGTTTCCCTTTTTTGACATCGCGCACTATCTAGTGTCAGTGATGGCGGTGAAACGTCAGCCGGGAGCAGCTGCATTGGCATGGAAGAATCCTATTTCAAGCTGGTTTACTGCTATGCTCCACTGTTTTGGTGGAGGAATTTTATCCTGTCTACTGCTTGCAGAGCCTCCATTGAAGTTTCTTGCAAACCACACTAACATATTACTGGCATCTTCAATCTGGTATATTACATTTTTTTGCCCGCATGACCTAGTTTCCCAGGGCTATTCATATCTACCTGTTCAACTACTGGCTTCGGGAATGAAGGAAGTGACCAGAACTTGGAAAATAGTAGGTGGAGTCACACATGCTAATAGCTATTACAAAAATGGCTGGATAGTCATGATAGCTATTGGATGGGCCCGAGGTGCAGGTGGTACCATTATAACGAATTTTGAGAGGTTGGTAAAAGGAGATTGGAAACCAGAAGGTGATGAATGGCTGAAGATGTCATACCCTGCCAAGGTAACCCTGCTGGGGTCAGTTATCTTCACATTCCAGCACACCCAGCATCTGGCAATATCAAAGCATAATCTTATGTTCCTTTATACCATCTTTATTGTGGCCACAAAGATAACCATGATGACTACACAGACTTCTACTATGACATTTGCTCCTTTTGAGGATACATTGAGTTGGATGCTATTTGGCTGGCAGCAGCCGTTTTCATCATGTGAGAAGAAAAGTGAAGCAAAGTCACCTTCCAATGGCGTTGGGTCATTGGCCTCAAAGCCGGTAGATGTTGCCTCAGATAATGTTAAAAAGAAACATACTAAGAAGAATGAATAA
ORF Protein Sequence MDSPWDELALAFSRTSMFPFFDIAHYLVSVMAVKRQPGAAALAWKNPISSWFTAMLHCFGGGILSCLLLAEPPLKFLANHTNILLASSIWYITFFCPHDLVSQGYSYLPVQLLASGMKEVTRTWKIVGGVTHANSYYKNGWIVMIAIGWARGAGGTIITNFERLVKGDWKPEGDEWLKMSYPAKVTLLGSVIFTFQHTQHLAISKHNLMFLYTIFIVATKITMMTTQTSTMTFAPFEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNVKKKHTKKNE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2097-Ab Anti-TMEM38B monoclonal antibody
    Target Antigen GM-Tg-g-IP2097-Ag TMEM38B protein
    ORF Viral Vector pGMLP003011 Human TMEM38B Lentivirus plasmid
    ORF Viral Vector vGMLP003011 Human TMEM38B Lentivirus particle


    Target information

    Target ID GM-IP2097
    Target Name TMEM38B
    Gene ID 55151, 52076, 715679, 362521, 101086352, 481654, 615646, 100060289
    Gene Symbol and Synonyms 1600017F22Rik,bA219P18.1,C9orf87,D4Ertd89e,mg33b,OI14,RGD1305703,TMEM38B,TRIC-B,TRICB
    Uniprot Accession Q9NVV0
    Uniprot Entry Name TM38B_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000095209
    Target Classification Ion Channel

    This gene encodes an intracellular monovalent cation channel that functions in maintenance of intracellular calcium release. Mutations in this gene may be associated with autosomal recessive osteogenesis. [provided by RefSeq, Oct 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.