Human GJA4/CX37 ORF/cDNA clone-Lentivirus particle (NM_002060)
Cat. No.: vGMLP003021
Pre-made Human GJA4/CX37 Lentiviral expression plasmid for GJA4 lentivirus packaging, GJA4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
Cx37/GJA4/CX37 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP003021 | Human GJA4 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP003021 |
| Gene Name | GJA4 |
| Accession Number | NM_002060 |
| Gene ID | 2701 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 1002 bp |
| Gene Alias | CX37 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGGTGACTGGGGCTTCCTGGAGAAGTTGCTGGACCAGGTCCAGGAGCACTCGACCGTGGTGGGTAAGATCTGGCTGACGGTGCTCTTCATCTTCCGCATCCTCATCCTGGGCCTGGCCGGCGAGTCAGTGTGGGGTGACGAGCAATCAGATTTCGAGTGTAACACGGCCCAGCCAGGCTGCACCAACGTCTGCTATGACCAGGCCTTCCCCATCTCCCACATCCGCTACTGGGTGCTGCAGTTCCTCTTCGTCAGCACACCCACCCTGGTCTACCTGGGCCATGTCATTTACCTGTCTCGGCGAGAAGAGCGGCTGCGGCAGAAGGAGGGGGAGCTGCGGGCACTGCCGGCCAAGGACCCACAGGTGGAGCGGGCGCTGGCGGCCGTAGAGCGTCAGATGGCCAAGATCTCGGTGGCAGAAGATGGTCGCCTGCGCATCCGCGGAGCACTGATGGGCACCTATGTCGCCAGTGTGCTCTGCAAGAGTGTGCTAGAGGCAGGCTTCCTCTATGGCCAGTGGCGCCTGTACGGCTGGACCATGGAGCCCGTGTTTGTGTGCCAGCGAGCACCCTGCCCCTACCTCGTGGACTGCTTTGTCTCTCGCCCCACGGAGAAGACCATCTTCATCATCTTCATGTTGGTGGTTGGACTCATCTCCCTGGTGCTTAACCTGCTGGAGTTGGTGCACCTGCTGTGTCGCTGCCTCAGCCGGGGGATGAGGGCACGGCAAGGCCAAGACGCACCCCCGACCCAGGGCACCTCCTCAGACCCTTACACGGACCAGGTCTTCTTCTACCTCCCCGTGGGCCAGGGGCCCTCATCCCCACCATGCCCCACCTACAATGGGCTCTCATCCAGTGAGCAGAACTGGGCCAACCTGACCACAGAGGAGAGGCTGGCGTCTTCCAGGCCCCCTCTCTTCCTGGACCCACCCCCTCAGAATGGCCAAAAACCCCCAAGTCGTCCCAGCAGCTCTGCTTCTAAGAAGCAGTATGTATAG |
| ORF Protein Sequence | MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP0179-Ab | Anti-Cx37 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP0179-Ag | Cx37/GJA4 protein |
| ORF Viral Vector | pGMLP003021 | Human GJA4 Lentivirus plasmid |
| ORF Viral Vector | vGMLP003021 | Human GJA4 Lentivirus particle |
Target information
| Target ID | GM-IP0179 |
| Target Name | Cx37 |
| Gene ID | 2701, 14612, 710913, 25655, 101084041, 538913, 100055536 |
| Gene Symbol and Synonyms | Cnx37,CX37,CXN37,Cxnh1,Gja-4,GJA4 |
| Uniprot Accession | P35212 |
| Uniprot Entry Name | CXA4_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000187513 |
| Target Classification | Not Available |
This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


