Human TMEM101 ORF/cDNA clone-Lentivirus particle (NM_032376)

Cat. No.: vGMLP003057

Pre-made Human TMEM101/ Lentiviral expression plasmid for TMEM101 lentivirus packaging, TMEM101 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TMEM101/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003057 Human TMEM101 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003057
Gene Name TMEM101
Accession Number NM_032376
Gene ID 84336
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 774 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGTCGAAGATAGGTTCGAGACGGTGGATGTTGCAGCTGATCATGCAGTTGGGTTCGGTGCTGCTCACACGCTGCCCCTTTTGGGGCTGCTTCAGCCAGCTCATGCTGTACGCTGAGAGGGCTGAGGCACGCCGGAAGCCCGACATCCCAGTGCCTTACCTGTATTTCGACATGGGGGCAGCCGTGCTGTGCGCTAGTTTCATGTCCTTTGGCGTGAAGCGGCGCTGGTTCGCGCTGGGGGCCGCACTCCAATTGGCCATTAGCACCTACGCCGCCTACATCGGGGGCTACGTCCACTACGGGGACTGGCTGAAGGTCCGTATGTACTCGCGCACAGTTGCCATCATCGGCGGCTTTCTTGTGTTGGCCAGCGGTGCTGGGGAGCTGTACCGCCGGAAACCTCGCAGCCGCTCCCTGCAGTCCACCGGCCAGGTGTTCCTGGGTATCTACCTCATCTGTGTGGCCTACTCACTGCAGCACAGCAAGGAGGACCGGCTGGCGTATCTGAACCATCTCCCAGGAGGGGAGCTGATGATCCAGCTGTTCTTCGTGCTGTATGGCATCCTGGCCCTGGCCTTTCTGTCAGGCTACTACGTGACCCTCGCTGCCCAGATCCTGGCTGTACTGCTGCCCCCTGTCATGCTGCTCATTGATGGCAATGTTGCTTACTGGCACAACACGCGGCGTGTTGAGTTCTGGAACCAGATGAAGCTCCTTGGAGAGAGTGTGGGCATCTTCGGAACTGCTGTCATCCTGGCCACTGATGGCTGA
ORF Protein Sequence MASKIGSRRWMLQLIMQLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMGAAVLCASFMSFGVKRRWFALGAALQLAISTYAAYIGGYVHYGDWLKVRMYSRTVAIIGGFLVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVAYSLQHSKEDRLAYLNHLPGGELMIQLFFVLYGILALAFLSGYYVTLAAQILAVLLPPVMLLIDGNVAYWHNTRRVEFWNQMKLLGESVGIFGTAVILATDG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1953-Ab Anti-TMEM101 monoclonal antibody
    Target Antigen GM-Tg-g-IP1953-Ag TMEM101 protein
    ORF Viral Vector pGMLP003057 Human TMEM101 Lentivirus plasmid
    ORF Viral Vector vGMLP003057 Human TMEM101 Lentivirus particle


    Target information

    Target ID GM-IP1953
    Target Name TMEM101
    Gene ID 84336, 76547, 714166, 303564, 101097284, 607173, 515507, 100051396
    Gene Symbol and Synonyms 2610511E22Rik,RGD1306490,TMEM101
    Uniprot Accession Q96IK0
    Uniprot Entry Name TM101_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000091947
    Target Classification Not Available

    Involved in positive regulation of I-kappaB kinase/NF-kappaB signaling. Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.