Human SAYSD1/C6orf64 ORF/cDNA clone-Lentivirus particle (NM_018322)

Cat. No.: vGMLP003070

Pre-made Human SAYSD1/C6orf64 Lentiviral expression plasmid for SAYSD1 lentivirus packaging, SAYSD1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SAYSD1/C6orf64 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003070 Human SAYSD1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003070
Gene Name SAYSD1
Accession Number NM_018322
Gene ID 55776
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 552 bp
Gene Alias C6orf64
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAACAGCGGTTAGCTGAGTTTCGGGCGGCGCGGAAACGGGCGGGTCTGGCGGCCCAACCCCCTGCTGCCAGTCAGGGCGCACAAACCCCAGGAGAGAAGGCGGAAGCAGCAGCGACTCTAAAGGCAGCCCCAGGCTGGCTAAAGCGGTTCCTGGTATGGAAACCTAGGCCCGCGAGTGCCCGGGCCCAGCCCGGCCTAGTTCAGGAAGCGGCTCAGCCCCAGGGCAGCACATCAGAGACACCATGGAACACAGCCATTCCTCTGCCGTCGTGCTGGGACCAGTCTTTCCTGACCAATATCACCTTCTTGAAGGTTCTTCTCTGGTTGGTCCTGCTGGGACTGTTTGTGGAACTGGAATTTGGCCTGGCATATTTTGTCCTGTCCTTGTTCTATTGGATGTACGTCGGGACACGAGGCCCTGAAGAGAAGAAAGAGGGAGAGAAGAGCGCCTACTCTGTGTTCAATCCAGGCTGTGAAGCCATCCAGGGCACCCTGACTGCAGAGCAGTTGGAGCGCGAGTTACAGTTGAGACCCCTGGCAGGGAGATAG
ORF Protein Sequence MEQRLAEFRAARKRAGLAAQPPAASQGAQTPGEKAEAAATLKAAPGWLKRFLVWKPRPASARAQPGLVQEAAQPQGSTSETPWNTAIPLPSCWDQSFLTNITFLKVLLWLVLLGLFVELEFGLAYFVLSLFYWMYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1572-Ab Anti-SAYSD1 monoclonal antibody
    Target Antigen GM-Tg-g-IP1572-Ag SAYSD1 protein
    ORF Viral Vector pGMLP003070 Human SAYSD1 Lentivirus plasmid
    ORF Viral Vector vGMLP003070 Human SAYSD1 Lentivirus particle


    Target information

    Target ID GM-IP1572
    Target Name SAYSD1
    Gene ID 55776, 67509, 719556, 305667, 105260571, 608740, 618888, 100054087
    Gene Symbol and Synonyms 1810063B07Rik,4930488P03Rik,C12H6orf64,C23H6orf64,C4H6orf64,C6orf64,RGD1310877,SAYSD1
    Uniprot Accession Q9NPB0
    Uniprot Entry Name SMDC1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000112167
    Target Classification Not Available

    Located in intracellular membrane-bounded organelle. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.