Human SMIM14/C4orf34 ORF/cDNA clone-Lentivirus particle (NM_174921)

Cat. No.: vGMLP003107

Pre-made Human SMIM14/C4orf34 Lentiviral expression plasmid for SMIM14 lentivirus packaging, SMIM14 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SMIM14/C4orf34 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003107 Human SMIM14 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003107
Gene Name SMIM14
Accession Number NM_174921
Gene ID 201895
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 300 bp
Gene Alias C4orf34
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGAAGGTGGATTTGATCCCTGTGAATGTGTTTGCTCTCATGAACATGCAATGAGAAGACTGATCAATCTGTTACGGCAGTCCCAGTCCTACTGCACAGACACAGAGTGTCTTCAGGAATTACCGGGACCCTCTGGTGATAATGGCATCAGTGTTACAATGATCTTGGTAGCCTGGATGGTTATTGCATTGATCTTGTTCTTACTGAGACCTCCTAATCTAAGAGGATCCAGCCTACCTGGAAAGCCAACCAGTCCTCATAATGGACAAGATCCACCAGCTCCTCCTGTGGACTAA
ORF Protein Sequence MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAWMVIALILFLLRPPNLRGSSLPGKPTSPHNGQDPPAPPVD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1765-Ab Anti-SMIM14 monoclonal antibody
    Target Antigen GM-Tg-g-IP1765-Ag SMIM14 protein
    ORF Viral Vector pGMLP003107 Human SMIM14 Lentivirus plasmid
    ORF Viral Vector vGMLP003107 Human SMIM14 Lentivirus particle


    Target information

    Target ID GM-IP1765
    Target Name SMIM14
    Gene ID 201895, 68552, 106998314, 364154, 101082820, 479105, 614774, 100064096
    Gene Symbol and Synonyms 1110003E01Rik,1700127H04Rik,5430439C17Rik,C3H4orf34,C4orf34,C6H4orf34,CB1H4orf34,MAd4,RGD1311122,SMIM14
    Uniprot Accession Q96QK8
    Uniprot Entry Name SIM14_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000163683
    Target Classification Not Available

    Predicted to act upstream of or within blastocyst hatching. Located in endoplasmic reticulum. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.