Human DAND5/CER2/CERL2 ORF/cDNA clone-Lentivirus particle (NM_152654)

Cat. No.: vGMLP003212

Pre-made Human DAND5/CER2/CERL2 Lentiviral expression plasmid for DAND5 lentivirus packaging, DAND5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to DAND5/CER2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003212 Human DAND5 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003212
Gene Name DAND5
Accession Number NM_152654
Gene ID 199699
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 570 bp
Gene Alias CER2,CERL2,CKTSF1B3,COCO,CRL2,DANTE,GREM3,SP1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTCCTTGGCCAGCTATCCACTCTTCTGTGCCTGCTTAGCGGGGCCCTGCCTACAGGCTCAGGGAGGCCTGAACCCCAGTCTCCTCGACCTCAGTCCTGGGCTGCAGCCAATCAGACCTGGGCTCTGGGCCCAGGGGCCCTGCCCCCACTGGTGCCAGCTTCTGCCCTTGGGAGCTGGAAGGCCTTCTTGGGCCTGCAGAAAGCCAGGCAGCTGGGGATGGGCAGGCTGCAGCGTGGGCAAGACGAGGTGGCTGCTGTGACTCTGCCGCTGAACCCTCAGGAAGTGATCCAGGGGATGTGTAAGGCTGTGCCCTTCGTTCAGGTGTTCTCCCGGCCCGGCTGCTCAGCCATACGCCTCCGAAATCATCTGTGCTTTGGTCATTGCTCCTCTCTCTACATCCCTGGCTCGGACCCCACCCCACTAGTCCTGTGCAACAGCTGTATGCCTGCTCGCAAGCGTTGGGCACCCGTGGTCCTGTGGTGTCTCACTGGCAGCTCAGCCTCCCGTCGACGGGTGAAGATATCCACCATGCTGATCGAGGGGTGTCACTGCAGCCCAAAAGCATGA
ORF Protein Sequence MLLGQLSTLLCLLSGALPTGSGRPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAFLGLQKARQLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0847-Ab Anti-DAND5/ CER2/ CERL2 functional antibody
    Target Antigen GM-Tg-g-SE0847-Ag DAND5 protein
    ORF Viral Vector pGMLP003212 Human DAND5 Lentivirus plasmid
    ORF Viral Vector vGMLP003212 Human DAND5 Lentivirus particle


    Target information

    Target ID GM-SE0847
    Target Name DAND5
    Gene ID 199699, 23863, 717076, 685719, 101081712, 484921, 100147180
    Gene Symbol and Synonyms CER2,Cerl-2,CERL2,Cerr2,CKTSF1B3,COCO,CRL2,DAND5,DANTE,Dte,GREM3,SP1
    Uniprot Accession Q8N907
    Uniprot Entry Name DAND5_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000179284
    Target Classification Not Available

    This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. In mouse, this protein has been shown to bind Nodal and to inhibit the Nodal signaling pathway which patterns left/right body asymmetry. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.