Human GH2/GH-V/GHB2 ORF/cDNA clone-Lentivirus particle (NM_002059)

Cat. No.: vGMLP003342

Pre-made Human GH2/GH-V/GHB2 Lentiviral expression plasmid for GH2 lentivirus packaging, GH2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GH2/GH-V products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003342 Human GH2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003342
Gene Name GH2
Accession Number NM_002059
Gene ID 2689
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 654 bp
Gene Alias GH-V,GHB2,GHL,GHV,hGH-V
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGCAGGCTCCCGGACGTCCCTGCTCCTGGCTTTTGGCCTGCTCTGCCTGTCCTGGCTTCAAGAGGGCAGTGCCTTCCCAACCATTCCCTTATCCAGGCTTTTTGACAACGCTATGCTCCGCGCCCGTCGCCTGTACCAGCTGGCATATGACACCTATCAGGAGTTTGAAGAAGCCTATATCCTGAAGGAGCAGAAGTATTCATTCCTGCAGAACCCCCAGACCTCCCTCTGCTTCTCAGAGTCTATTCCAACACCTTCCAACAGGGTGAAAACGCAGCAGAAATCTAACCTAGAGCTGCTCCGCATCTCCCTGCTGCTCATCCAGTCATGGCTGGAGCCCGTGCAGCTCCTCAGGAGCGTCTTCGCCAACAGCCTGGTGTATGGCGCCTCGGACAGCAACGTCTATCGCCACCTGAAGGACCTAGAGGAAGGCATCCAAACGCTGATGTGGAGGCTGGAAGATGGCAGCCCCCGGACTGGGCAGATCTTCAATCAGTCCTACAGCAAGTTTGACACAAAATCGCACAACGATGACGCACTGCTCAAGAACTACGGGCTGCTCTACTGCTTCAGGAAGGACATGGACAAGGTCGAGACATTCCTGCGCATCGTGCAGTGCCGCTCTGTGGAGGGCAGCTGTGGCTTCTAG
ORF Protein Sequence MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0945-Ab Anti-SOM2/ GH2/ GH-V functional antibody
    Target Antigen GM-Tg-g-SE0945-Ag GH2 protein
    ORF Viral Vector pGMLP003342 Human GH2 Lentivirus plasmid
    ORF Viral Vector vGMLP003342 Human GH2 Lentivirus particle


    Target information

    Target ID GM-SE0945
    Target Name GH2
    Gene ID 2689
    Gene Symbol and Synonyms GH-V,GH2,GHB2,GHL,GHV,hGH-V
    Uniprot Accession P01242
    Uniprot Entry Name SOM2_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000136487
    Target Classification Not Available

    The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. As in the case of its pituitary counterpart, growth hormone 1, the predominant isoform of this particular family member shows similar somatogenic activity, with reduced lactogenic activity. Mutations in this gene lead to placental growth hormone/lactogen deficiency. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.