Human CNEP1R1/C16orf69/NEP1-R1 ORF/cDNA clone-Lentivirus particle (NM_153261)

Cat. No.: vGMLP003403

Pre-made Human CNEP1R1/C16orf69/NEP1-R1 Lentiviral expression plasmid for CNEP1R1 lentivirus packaging, CNEP1R1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CNEP1R1/C16orf69 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003403 Human CNEP1R1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003403
Gene Name CNEP1R1
Accession Number NM_153261
Gene ID 255919
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 429 bp
Gene Alias C16orf69,NEP1-R1,NEP1R1,TMEM188,TMP125
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACTCGCTGGAGCAGGCGGAAGCCCCGCGAGTTGTATCCCTGATTCCTGCGGTGGTTTCCGGTAACTGCCAAGATCTCAAGGCTTTTGAGAGGAGACTTACTGAATATATTCATTGTTTGCAACCTGCTACTGGACGCTGGAGAATGCTTCTTATAGTGGTATCTGTCTGTACAGCTACTGGTGCCTGGAACTGGTTAATAGACCCTGAGACACAAAAGGTGTCCTTCTTCACATCATTATGGAATCACCCATTTTTCACCATTAGCTGTATCACTCTAATAGGCTTGTTCTTTGCTGGAATACACAAGAGAGTAGTTGCACCATCAATTATAGCTGCTCGATGTCGAACGGTATTAGCAGAATACAATATGTCTTGTGATGATACAGGAAAACTAATTTTGAAACCTAGGCCTCATGTTCAATGA
ORF Protein Sequence MNSLEQAEAPRVVSLIPAVVSGNCQDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSFFTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHVQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2876-Ab Anti-CNEP1R1 monoclonal antibody
    Target Antigen GM-Tg-g-IP2876-Ag CNEP1R1 protein
    ORF Viral Vector pGMLP003403 Human CNEP1R1 Lentivirus plasmid
    ORF Viral Vector vGMLP003403 Human CNEP1R1 Lentivirus particle


    Target information

    Target ID GM-IP2876
    Target Name CNEP1R1
    Gene ID 255919, 382030, 694061, 291914, 101091242, 609448, 507593, 100630817
    Gene Symbol and Synonyms 5033428A16Rik,C16orf69,CNEP1R1,NEP1-R1,NEP1R1,RGD1308816,TMEM188,TMP125
    Uniprot Accession Q8N9A8
    Uniprot Entry Name NEPR1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000205423
    Target Classification Not Available

    This gene encodes a transmembrane protein that belongs to the Tmemb_18A family. A similar protein in yeast is a component of an endoplasmic reticulum-associated protein phosphatase complex and is thought to play a role in the synthesis of triacylglycerol. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.