Human FAM96A/CIA2A ORF/cDNA clone-Lentivirus particle (NM_032231)

Cat. No.: vGMLP003413

Pre-made Human FAM96A/CIA2A Lentiviral expression plasmid for FAM96A lentivirus packaging, FAM96A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CIAO2A/FAM96A/CIA2A products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003413 Human FAM96A Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003413
Gene Name FAM96A
Accession Number NM_032231
Gene ID 84191
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 483 bp
Gene Alias CIA2A
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGCGGGTGTCCGGGCTGCTCTCCTGGACGCTGAGCAGAGTCCTGTGGCTCTCCGGCCTCTCTGAGCCGGGAGCTGCCCGGCAGCCCCGGATCATGGAAGAGAAAGCGCTAGAAGTTTATGATTTGATTAGAACTATCCGGGACCCAGAAAAGCCCAATACTTTAGAAGAACTGGAAGTGGTCTCGGAAAGTTGTGTGGAAGTTCAGGAGATAAATGAAGAAGAATATCTGGTTATTATCAGGTTCACGCCAACAGTACCTCATTGCTCTTTGGCGACTCTTATTGGGCTGTGCTTAAGAGTAAAACTTCAGCGATGTTTACCATTTAAACATAAGTTGGAAATCTACATTTCTGAAGGAACCCACTCAACAGAAGAAGACATCAATAAGCAGATAAATGACAAAGAGCGAGTGGCAGCTGCAATGGAAAACCCCAACTTACGGGAAATTGTGGAACAGTGTGTCCTTGAACCTGACTGA
ORF Protein Sequence MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1575-Ab Anti-CIA2A/ CIAO2A/ FAM96A functional antibody
    Target Antigen GM-Tg-g-SE1575-Ag CIAO2A protein
    ORF Viral Vector pGMLP003413 Human FAM96A Lentivirus plasmid
    ORF Viral Vector vGMLP003413 Human FAM96A Lentivirus particle


    Target information

    Target ID GM-SE1575
    Target Name CIAO2A
    Gene ID 84191, 68250, 712029, 300797, 101089269, 478335, 512871, 100053881
    Gene Symbol and Synonyms 5730536A07Rik,CIA2A,CIAO2A,FAM96A,RGD1307481
    Uniprot Accession Q9H5X1
    Uniprot Entry Name CIA2A_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000166797
    Target Classification Not Available

    Predicted to enable metal ion binding activity. Involved in iron-sulfur cluster assembly and protein maturation by iron-sulfur cluster transfer. Located in cytosol and nucleoplasm. Part of CIA complex. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.