Human INO80C/C18orf37/hIes6 ORF/cDNA clone-Lentivirus particle (NM_194281)

Cat. No.: vGMLP003432

Pre-made Human INO80C/C18orf37/hIes6 Lentiviral expression plasmid for INO80C lentivirus packaging, INO80C lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to INO80C/C18orf37 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003432 Human INO80C Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003432
Gene Name INO80C
Accession Number NM_194281
Gene ID 125476
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 579 bp
Gene Alias C18orf37,hIes6,IES6
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCGCAAATTCCAATTGTGGCCACCACTTCCACTCCCGGAATAGTCCGGAACAGCAAGAAGAGGCCGGCCAGCCCTTCCCACAATGGCAGCAGCGGCGGGGGCTATGGCGCCAGTAAGAAGAAAAAAGCGTCCGCTTCCAGCTTTGCGCAGGGTATCAGCATGGAAGCCATGAGTGAGAATAAAATGGTGCCCTCTGAGTTTAGCACAGGACCTGTGGAAAAAGCTGCCAAACCTTTGCCATTTAAGGATCCCAACTTTGTGCACTCTGGCCACGGTGGCGCAGTAGCTGGCAAGAAGAACAGAACCTGGAAGAACCTGAAACAAATCCTCGCTTCTGAAAGGGCATTGCCGTGGCAACTGAACGATCCTAACTACTTCAGTATTGATGCTCCTCCATCCTTTAAGCCAGCTAAGAAGTATTCTGATGTTTCAGGTCTGCTTGCCAACTACACAGACCCCCAGAGCAAACTGCGGTTCAGCACCATTGAAGAGTTTTCCTACATTCGGAGGCTGCCCTCTGACGTCGTCACCGGCTACCTGGCCCTGAGGAAGGCCACGAGCATCGTTCCCTGA
ORF Protein Sequence MAAQIPIVATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISMEAMSENKMVPSEFSTGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRTWKNLKQILASERALPWQLNDPNYFSIDAPPSFKPAKKYSDVSGLLANYTDPQSKLRFSTIEEFSYIRRLPSDVVTGYLALRKATSIVP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1012-Ab Anti-INO80C monoclonal antibody
    Target Antigen GM-Tg-g-IP1012-Ag INO80C protein
    ORF Viral Vector pGMLP003432 Human INO80C Lentivirus plasmid
    ORF Viral Vector vGMLP003432 Human INO80C Lentivirus particle


    Target information

    Target ID GM-IP1012
    Target Name INO80C
    Gene ID 125476, 225280, 708819, 291737, 101094214, 490484, 533426, 100052780
    Gene Symbol and Synonyms C18orf37,D030070L09Rik,hIes6,IES6,INO80C,RGD1310199
    Uniprot Accession Q6PI98
    Uniprot Entry Name IN80C_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000153391
    Target Classification Not Available

    Predicted to be involved in chromatin remodeling. Part of Ino80 complex and MLL1 complex. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.