Human INO80C/C18orf37/hIes6 ORF/cDNA clone-Lentivirus particle (NM_194281)
Cat. No.: vGMLP003432
Pre-made Human INO80C/C18orf37/hIes6 Lentiviral expression plasmid for INO80C lentivirus packaging, INO80C lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
INO80C/C18orf37 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP003432 | Human INO80C Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP003432 |
| Gene Name | INO80C |
| Accession Number | NM_194281 |
| Gene ID | 125476 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 579 bp |
| Gene Alias | C18orf37,hIes6,IES6 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCGGCGCAAATTCCAATTGTGGCCACCACTTCCACTCCCGGAATAGTCCGGAACAGCAAGAAGAGGCCGGCCAGCCCTTCCCACAATGGCAGCAGCGGCGGGGGCTATGGCGCCAGTAAGAAGAAAAAAGCGTCCGCTTCCAGCTTTGCGCAGGGTATCAGCATGGAAGCCATGAGTGAGAATAAAATGGTGCCCTCTGAGTTTAGCACAGGACCTGTGGAAAAAGCTGCCAAACCTTTGCCATTTAAGGATCCCAACTTTGTGCACTCTGGCCACGGTGGCGCAGTAGCTGGCAAGAAGAACAGAACCTGGAAGAACCTGAAACAAATCCTCGCTTCTGAAAGGGCATTGCCGTGGCAACTGAACGATCCTAACTACTTCAGTATTGATGCTCCTCCATCCTTTAAGCCAGCTAAGAAGTATTCTGATGTTTCAGGTCTGCTTGCCAACTACACAGACCCCCAGAGCAAACTGCGGTTCAGCACCATTGAAGAGTTTTCCTACATTCGGAGGCTGCCCTCTGACGTCGTCACCGGCTACCTGGCCCTGAGGAAGGCCACGAGCATCGTTCCCTGA |
| ORF Protein Sequence | MAAQIPIVATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISMEAMSENKMVPSEFSTGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRTWKNLKQILASERALPWQLNDPNYFSIDAPPSFKPAKKYSDVSGLLANYTDPQSKLRFSTIEEFSYIRRLPSDVVTGYLALRKATSIVP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP1012-Ab | Anti-INO80C monoclonal antibody |
| Target Antigen | GM-Tg-g-IP1012-Ag | INO80C protein |
| ORF Viral Vector | pGMLP003432 | Human INO80C Lentivirus plasmid |
| ORF Viral Vector | vGMLP003432 | Human INO80C Lentivirus particle |
Target information
| Target ID | GM-IP1012 |
| Target Name | INO80C |
| Gene ID | 125476, 225280, 708819, 291737, 101094214, 490484, 533426, 100052780 |
| Gene Symbol and Synonyms | C18orf37,D030070L09Rik,hIes6,IES6,INO80C,RGD1310199 |
| Uniprot Accession | Q6PI98 |
| Uniprot Entry Name | IN80C_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000153391 |
| Target Classification | Not Available |
Predicted to be involved in chromatin remodeling. Part of Ino80 complex and MLL1 complex. [provided by Alliance of Genome Resources, Apr 2022]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


