Human RGS4/RGP4/SCZD9 ORF/cDNA clone-Lentivirus particle (NM_005613)

Cat. No.: vGMLP003445

Pre-made Human RGS4/RGP4/SCZD9 Lentiviral expression plasmid for RGS4 lentivirus packaging, RGS4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RGS4/RGP4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003445 Human RGS4 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003445
Gene Name RGS4
Accession Number NM_005613
Gene ID 5999
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 618 bp
Gene Alias RGP4,SCZD9
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGCAAAGGGCTTGCAGGTCTGCCGGCTTCTTGCTTGAGGAGTGCAAAAGATATGAAACATCGGCTAGGTTTCCTGCTGCAAAAATCTGATTCCTGTGAACACAATTCTTCCCACAACAAGAAGGACAAAGTGGTTATTTGCCAGAGAGTGAGCCAAGAGGAAGTCAAGAAATGGGCTGAATCACTGGAAAACCTGATTAGTCATGAATGTGGGCTGGCAGCTTTCAAAGCTTTCTTGAAGTCTGAATATAGTGAGGAGAATATTGACTTCTGGATCAGCTGTGAAGAGTACAAGAAAATCAAATCACCATCTAAACTAAGTCCCAAGGCCAAAAAGATCTATAATGAATTCATCTCAGTCCAGGCAACCAAAGAGGTGAACCTGGATTCTTGCACCAGGGAAGAGACAAGCCGGAACATGCTAGAGCCTACAATAACCTGCTTTGATGAGGCCCAGAAGAAGATTTTCAACCTGATGGAGAAGGATTCCTACCGCCGCTTCCTCAAGTCTCGATTCTATCTTGATTTGGTCAACCCGTCCAGCTGTGGGGCAGAAAAGCAGAAAGGAGCCAAGAGTTCAGCAGACTGTGCTTCCCTGGTCCCTCAGTGTGCCTAA
ORF Protein Sequence MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T93580-Ab Anti-RGS4 monoclonal antibody
    Target Antigen GM-Tg-g-T93580-Ag RGS4 protein
    ORF Viral Vector pGMLP003445 Human RGS4 Lentivirus plasmid
    ORF Viral Vector vGMLP003445 Human RGS4 Lentivirus particle


    Target information

    Target ID GM-T93580
    Target Name RGS4
    Gene ID 5999, 19736, 693383, 29480, 101083058, 488666, 617437, 100058342
    Gene Symbol and Synonyms ESTM48,ESTM50,RGP4,RGS4,SCZD9
    Uniprot Accession P49798
    Uniprot Entry Name RGS4_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000117152
    Target Classification Not Available

    Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. Regulator of G protein signaling 4 protein is 37% identical to RGS1 and 97% identical to rat Rgs4. This protein negatively regulate signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.