Human YWHAH/YWHA1 ORF/cDNA clone-Lentivirus particle (NM_003405)

Cat. No.: vGMLP003482

Pre-made Human YWHAH/YWHA1 Lentiviral expression plasmid for YWHAH lentivirus packaging, YWHAH lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to YWHAH/YWHA1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003482 Human YWHAH Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003482
Gene Name YWHAH
Accession Number NM_003405
Gene ID 7533
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 741 bp
Gene Alias YWHA1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGGACCGGGAGCAGCTGCTGCAGCGGGCGCGGCTGGCCGAGCAGGCGGAGCGCTACGACGACATGGCCTCCGCTATGAAGGCGGTGACAGAGCTGAATGAACCTCTCTCCAATGAAGATCGAAATCTCCTCTCTGTGGCCTACAAGAATGTGGTTGGTGCCAGGCGATCTTCCTGGAGGGTCATTAGCAGCATTGAGCAGAAAACCATGGCTGATGGAAACGAAAAGAAATTGGAGAAAGTTAAAGCTTACCGGGAGAAGATTGAGAAGGAGCTGGAGACAGTTTGCAATGATGTCCTGTCTCTGCTTGACAAGTTCCTGATCAAGAACTGCAATGATTTCCAGTATGAGAGCAAGGTGTTTTACCTGAAAATGAAGGGTGATTACTACCGCTACTTAGCAGAGGTCGCTTCTGGGGAGAAGAAAAACAGTGTGGTCGAAGCTTCTGAAGCTGCCTACAAGGAAGCCTTTGAAATCAGCAAAGAGCAGATGCAACCCACGCATCCCATCCGGCTGGGCCTGGCCCTCAACTTCTCCGTGTTCTACTATGAGATCCAGAATGCACCTGAGCAAGCCTGCCTCTTAGCCAAACAAGCCTTCGATGATGCCATAGCTGAGCTGGACACACTAAACGAGGATTCCTATAAGGACTCCACGCTGATCATGCAGTTGCTGCGAGACAACCTCACCCTCTGGACGAGCGACCAGCAGGATGAAGAAGCAGGAGAAGGCAACTGA
ORF Protein Sequence MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T52886-Ab Anti-YWHAH monoclonal antibody
    Target Antigen GM-Tg-g-T52886-Ag YWHAH protein
    ORF Viral Vector pGMLP003482 Human YWHAH Lentivirus plasmid
    ORF Viral Vector vGMLP003482 Human YWHAH Lentivirus particle


    Target information

    Target ID GM-T52886
    Target Name YWHAH
    Gene ID 7533, 22629, 717016, 25576, 101099908, 100687866, 282126, 100062878
    Gene Symbol and Synonyms 14-3-3e,YWHA1,YWHAH
    Uniprot Accession Q04917
    Uniprot Entry Name 1433F_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease lung cancer
    Gene Ensembl ENSG00000128245
    Target Classification Not Available

    This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. [provided by RefSeq, Jun 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.