Human GATD3A/C21orf33/ES1 ORF/cDNA clone-Lentivirus particle (NM_004649)
Cat. No.: vGMLP003494
Pre-made Human GATD3A/C21orf33/ES1 Lentiviral expression plasmid for GATD3A lentivirus packaging, GATD3A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
GATD3A/C21orf33 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP003494 | Human GATD3A Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP003494 |
| Gene Name | GATD3A |
| Accession Number | NM_004649 |
| Gene ID | 8209 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 807 bp |
| Gene Alias | C21orf33,ES1,GATD3,GT335,HES1,KNPH,KNPI |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCGGCTGTGAGGGTCCTGGTGGCCTCGAGGCTCGCTGCGGCATCTGCATTCACGTCCCTGTCCCCCGGCGGTCGGACGCCTTCCCAGCGCGCAGCCCTTCACCTCTCCGTGCCGCGCCCCGCGGCCAGGGTCGCGCTGGTGCTGTCTGGATGCGGAGTCTACGATGGGACCGAGATCCACGAGGCCTCGGCGATCCTGGTGCACCTGAGCCGTGGAGGGGCTGAAGTCCAGATCTTTGCTCCTGACGTCCCTCAGATGCACGTGATTGACCACACCAAGGGGCAGCCGTCCGAAGGCGAGAGCAGGAATGTTTTGACCGAGTCTGCGAGGATCGCCCGTGGCAAAATCACAGACCTGGCCAACCTCAGTGCAGCCAACCATGATGCTGCCATCTTTCCAGGAGGCTTTGGAGCGGCTAAAAACCTGAGCACGTTTGCCGTGGACGGGAAAGATTGCAAGGTGAATAAAGAAGTGGAGCGTGTCCTGAAGGAGTTCCACCAGGCCGGGAAGCCCATCGGCTTGTGCTGCATTGCACCTGTCCTCGCGGCCAAGGTGCTCAGAGGCGTCGAGGTGACTGTGGGCCACGAGCAGGAGGAAGGTGGCAAGTGGCCTTATGCCGGGACCGCAGAGGCCATCAAGGCCCTGGGTGCCAAGCACTGCGTGAAGGAAGTGGTCGAAGCTCACGTGGACCAGAAAAACAAGGTGGTCACGACCCCAGCCTTCATGTGCGAGACGGCACTCCACTACATCCATGATGGGATCGGAGCCATGGTGAGGAAGGTGCTGGAACTCACTGGAAAGTGA |
| ORF Protein Sequence | MAAVRVLVASRLAAASAFTSLSPGGRTPSQRAALHLSVPRPAARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1549-Ab | Anti-GAL3A/ GATD3A/ C21orf33 functional antibody |
| Target Antigen | GM-Tg-g-SE1549-Ag | GATD3A protein |
| ORF Viral Vector | pGMLP003494 | Human GATD3A Lentivirus plasmid |
| ORF Viral Vector | vGMLP003494 | Human GATD3A Lentivirus particle |
Target information
| Target ID | GM-SE1549 |
| Target Name | GATD3A |
| Gene ID | 8209, 28295, 713055, 294326, 101091803, 611316, 514335, 100057089 |
| Gene Symbol and Synonyms | C1H21orf33,C21orf33,C26H21orf33,C31H21orf33,C3H21orf33,CC2H21orf33,D10Jhu81e,ES1,GATD3,GATD3A,GT335,HES1,KNPH,KNPI,RGD1303003 |
| Uniprot Accession | P0DPI2 |
| Uniprot Entry Name | GAL3A_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000160221 |
| Target Classification | Not Available |
This gene encodes a potential mitochondrial protein that is a member of the DJ-1/PfpI gene family. This protein is overexpressed in fetal Down syndrome brain. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


