Human PDX1/GSF/IDX-1 ORF/cDNA clone-Lentivirus particle (NM_000209)
Cat. No.: vGMLP003507
Pre-made Human PDX1/GSF/IDX-1 Lentiviral expression plasmid for PDX1 lentivirus packaging, PDX1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
PDX1/GSF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP003507 | Human PDX1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP003507 |
| Gene Name | PDX1 |
| Accession Number | NM_000209 |
| Gene ID | 3651 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 852 bp |
| Gene Alias | GSF,IDX-1,IPF1,IUF1,MODY4,PAGEN1,PDX-1,STF-1 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAACGGCGAGGAGCAGTACTACGCGGCCACGCAGCTTTACAAGGACCCATGCGCGTTCCAGCGAGGCCCGGCGCCGGAGTTCAGCGCCAGCCCCCCTGCGTGCCTGTACATGGGCCGCCAGCCCCCGCCGCCGCCGCCGCACCCGTTCCCTGGCGCCCTGGGCGCGCTGGAGCAGGGCAGCCCCCCGGACATCTCCCCGTACGAGGTGCCCCCCCTCGCCGACGACCCCGCGGTGGCGCACCTTCACCACCACCTCCCGGCTCAGCTCGCGCTCCCCCACCCGCCCGCCGGGCCCTTCCCGGAGGGAGCCGAGCCGGGCGTCCTGGAGGAGCCCAACCGCGTCCAGCTGCCTTTCCCATGGATGAAGTCTACCAAAGCTCACGCGTGGAAAGGCCAGTGGGCAGGCGGCGCCTACGCTGCGGAGCCGGAGGAGAACAAGCGGACGCGCACGGCCTACACGCGCGCACAGCTGCTAGAGCTGGAGAAGGAGTTCCTATTCAACAAGTACATCTCACGGCCGCGCCGGGTGGAGCTGGCTGTCATGTTGAACTTGACCGAGAGACACATCAAGATCTGGTTCCAAAACCGCCGCATGAAGTGGAAAAAGGAGGAGGACAAGAAGCGCGGCGGCGGGACAGCTGTCGGGGGTGGCGGGGTCGCGGAGCCTGAGCAGGACTGCGCCGTGACCTCCGGCGAGGAGCTTCTGGCGCTGCCGCCGCCGCCGCCCCCCGGAGGTGCTGTGCCGCCCGCTGCCCCCGTTGCCGCCCGAGAGGGCCGCCTGCCGCCTGGCCTTAGCGCGTCGCCACAGCCCTCCAGCGTCGCGCCTCGGCGGCCGCAGGAACCACGATGA |
| ORF Protein Sequence | MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T35983-Ab | Anti-PDX1 monoclonal antibody |
| Target Antigen | GM-Tg-g-T35983-Ag | PDX1 protein |
| ORF Viral Vector | pGMLP003507 | Human PDX1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP003507 | Human PDX1 Lentivirus particle |
Target information
| Target ID | GM-T35983 |
| Target Name | PDX1 |
| Gene ID | 3651, 18609, 710936, 29535, 100240682, 493994, 538927, 100051336 |
| Gene Symbol and Synonyms | GSF,IDX-1,Idx1,IPF-1,IPF1,IUF1,MODY4,PAGEN1,PDX-1,PDX1,STF-1,Stf1 |
| Uniprot Accession | P52945 |
| Uniprot Entry Name | PDX1_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | Cancer |
| Gene Ensembl | ENSG00000139515 |
| Target Classification | Tumor-associated antigen (TAA) |
The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (IDDM), as well as maturity onset diabetes of the young type 4 (MODY4). [provided by RefSeq, Aug 2017]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


