Human GJD3/Cx30.2/CX31.9 ORF/cDNA clone-Lentivirus particle (NM_152219)

Cat. No.: vGMLP003517

Pre-made Human GJD3/Cx30.2/CX31.9 Lentiviral expression plasmid for GJD3 lentivirus packaging, GJD3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to Cx31.9/GJD3/Cx30.2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003517 Human GJD3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003517
Gene Name GJD3
Accession Number NM_152219
Gene ID 125111
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 885 bp
Gene Alias Cx30.2,CX31.9,GJA11,GJC1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGGAGTGGGCGTTCCTGGGCTCGCTGCTGGACGCCGTGCAGCTGCAGTCGCCGCTCGTGGGCCGCCTCTGGCTGGTGGTCATGCTGATCTTCCGCATCCTGGTGCTGGCCACGGTGGGCGGCGCCGTGTTCGAGGACGAGCAAGAGGAGTTCGTGTGCAACACGCTGCAGCCGGGCTGTCGCCAGACCTGCTACGACCGCGCCTTCCCGGTCTCCCACTACCGCTTCTGGCTCTTCCACATCCTGCTGCTCTCGGCGCCCCCGGTGCTGTTCGTCGTCTACTCCATGCACCGGGCAGGCAAGGAGGCGGGCGGCGCTGAGGCGGCGGCGCAGTGCGCCCCCGGACTGCCCGAGGCCCAGTGCGCGCCGTGCGCCCTGCGCGCCCGCCGCGCGCGCCGCTGCTACCTGCTGAGCGTGGCGCTGCGCCTGCTGGCCGAGCTGACCTTCCTGGGCGGCCAGGCGCTGCTCTACGGCTTCCGCGTGGCCCCGCACTTCGCGTGCGCCGGTCCGCCCTGCCCGCACACGGTCGACTGCTTCGTGAGCCGGCCCACCGAGAAGACCGTCTTCGTGCTCTTCTATTTCGCGGTGGGGCTGCTGTCGGCGCTGCTCAGCGTAGCCGAGCTGGGCCACCTGCTCTGGAAGGGCCGCCCGCGCGCCGGGGAGCGTGACAACCGCTGCAACCGTGCACACGAAGAGGCGCAGAAGCTGCTCCCGCCGCCGCCGCCGCCACCTCCGCCACCGGCCCTGCCCTCCCGGCGCCCCGGCCCCGAGCCGTGCGCCCCGCCGGCCTATGCGCACCCGGCGCCGGCCAGCCTCCGCGAGTGCGGCAGCGGCCGCGGCAAGGCGTCACCGGCCACCGGCCGCCGAGATCTGGCCATCTAG
ORF Protein Sequence MGEWAFLGSLLDAVQLQSPLVGRLWLVVMLIFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLFHILLLSAPPVLFVVYSMHRAGKEAGGAEAAAQCAPGLPEAQCAPCALRARRARRCYLLSVALRLLAELTFLGGQALLYGFRVAPHFACAGPPCPHTVDCFVSRPTEKTVFVLFYFAVGLLSALLSVAELGHLLWKGRPRAGERDNRCNRAHEEAQKLLPPPPPPPPPPALPSRRPGPEPCAPPAYAHPAPASLRECGSGRGKASPATGRRDLAI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0204-Ab Anti-Cx31.9 monoclonal antibody
    Target Antigen GM-Tg-g-IP0204-Ag Cx31.9/GJD3 protein
    ORF Viral Vector pGMLP003517 Human GJD3 Lentivirus plasmid
    ORF Viral Vector vGMLP003517 Human GJD3 Lentivirus particle


    Target information

    Target ID GM-IP0204
    Target Name Cx31.9
    Gene ID 125111, 353155, 700473, 363677, 111557744, 100685801, 616824, 100067747
    Gene Symbol and Synonyms Cx30.2,CX31.9,Cxnr,GJA11,GJC1,GJD3
    Uniprot Accession Q8N144
    Uniprot Entry Name CXD3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000183153
    Target Classification Not Available

    This gene is a member of the large family of connexins that are required for the formation of gap junctions. Six connexin monomers form a hemichannel, or connexon, on the cell surface. This connexon can interact with a connexon from a neighboring cell, thus forming a channel linking the cytoplasm of the 2 cells. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.