Human EIF2B1/EIF2B/EIF2BA ORF/cDNA clone-Lentivirus particle (NM_001414)
Cat. No.: vGMLP003525
Pre-made Human EIF2B1/EIF2B/EIF2BA Lentiviral expression plasmid for EIF2B1 lentivirus packaging, EIF2B1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
EIF2B1/EIF2B products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP003525 | Human EIF2B1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP003525 |
| Gene Name | EIF2B1 |
| Accession Number | NM_001414 |
| Gene ID | 1967 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 918 bp |
| Gene Alias | EIF2B,EIF2BA |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGACGACAAGGAGTTAATTGAATACTTTAAGTCTCAGATGAAAGAAGATCCTGACATGGCCTCAGCAGTGGCTGCCATCCGGACGTTGCTGGAGTTCTTGAAGAGAGATAAAGGGGAGACAATCCAGGGTCTGAGGGCGAATCTCACCAGTGCCATAGAAACCCTGTGTGGTGTGGACTCCTCTGTGGCAGTGTCCTCTGGCGGGGAGCTCTTCCTCCGCTTCATCAGTCTTGCCTCCCTGGAATACTCCGATTACTCCAAATGTAAAAAGATCATGATTGAGCGGGGAGAACTTTTTCTCAGGAGAATATCACTGTCAAGAAACAAAATTGCAGATCTGTGCCATACTTTCATCAAAGATGGAGCGACAATATTGACTCACGCCTACTCCAGAGTGGTCCTGAGAGTCCTGGAAGCAGCCGTGGCGGCCAAGAAGCGATTTAGTGTATACGTCACAGAGTCACAGCCTGATTTGTCAGGTAAGAAAATGGCCAAAGCCCTCTGCCACCTCAACGTCCCTGTCACTGTGGTGCTAGATGCTGCTGTCGGCTACATCATGGAGAAAGCAGATCTTGTCATAGTTGGTGCTGAAGGAGTTGTTGAAAACGGAGGAATTATTAACAAGATTGGAACCAACCAGATGGCTGTGTGTGCCAAAGCACAGAACAAACCTTTCTATGTGGTTGCAGAAAGTTTCAAGTTTGTCCGGCTCTTTCCACTAAACCAGCAAGACGTCCCAGATAAGTTTAAGTATAAGGCAGACACTCTCAAGGTCGCGCAGACTGGACAAGACCTCAAAGAGGAGCATCCGTGGGTCGACTACACTGCCCCTTCCTTAATCACTCTGCTGTTTACAGACCTGGGCGTGCTGACACCCTCAGCAGTCAGCGATGAGCTCATCAAGCTCTATCTGTAA |
| ORF Protein Sequence | MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-TA045-Ab | Anti-EIF2B1 monoclonal antibody |
| Target Antigen | GM-Tg-g-TA045-Ag | EIF2B1 protein |
| ORF Viral Vector | pGMLP003525 | Human EIF2B1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP003525 | Human EIF2B1 Lentivirus particle |
Target information
| Target ID | GM-TA045 |
| Target Name | EIF2B1 |
| Gene ID | 1967, 209354, 705438, 64514, 101100158, 477447, 516670, 100059129 |
| Gene Symbol and Synonyms | D5Ertd406e,eIF-2a,EIF2B,EIF2B1,EIF2BA,EIF2Balpha,VWM1 |
| Uniprot Accession | Q14232 |
| Uniprot Entry Name | EI2BA_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000111361 |
| Target Classification | Not Available |
This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter. [provided by RefSeq, Oct 2009]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


