Human B4GALT6/B4Gal-T6/beta4Gal-T6 ORF/cDNA clone-Lentivirus particle (NM_004775)

Cat. No.: vGMLP003618

Pre-made Human B4GALT6/B4Gal-T6/beta4Gal-T6 Lentiviral expression plasmid for B4GALT6 lentivirus packaging, B4GALT6 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to B4GALT6/B4Gal-T6 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003618 Human B4GALT6 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003618
Gene Name B4GALT6
Accession Number NM_004775
Gene ID 9331
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1149 bp
Gene Alias B4Gal-T6,beta4Gal-T6
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTGTGCTCAGGCGGATGATGCGGGTTTCCAATCGCTCTCTCCTCGCCTTCATCTTCTTCTTCTCCCTCTCTTCGTCCTGTCTGTACTTCATCTATGTGGCCCCAGGCATCGCCAACACATATCTCTTTATGGTACAAGCTCGAGGTATAATGTTGAGAGAAAATGTGAAAACAATAGGTCATATGATCAGGCTGTACACAAATAAAAACAGTACGCTCAACGGTACAGATTATCCCGAAGGCAATAATTCAAGTGATTATCTTGTTCAAACAACAACGTATCTCCCGGAAAACTTCACATACTCACCATACCTCCCCTGTCCAGAAAAGCTGCCTTATATGCGAGGATTCCTCAATGTCAATGTAAGCGAAGTCAGTTTTGATGAAATTCATCAACTCTTCTCCAAGGATTTAGATATTGAGCCAGGGGGTCATTGGAGGCCAAAAGACTGTAAACCCAGATGGAAGGTGGCAGTTCTCATTCCTTTCCGTAATCGCCATGAACATCTTCCAATTTTTTTCTTACATCTGATTCCAATGCTCCAGAAGCAGCGGCTGGAATTTGCGTTTTATGTCATTGAACAGACTGGCACACAACCTTTTAACCGTGCGATGCTTTTCAATGTGGGCTTCAAAGAGGCCATGAAAGACAGTGTCTGGGACTGTGTAATCTTCCACGATGTGGATCATCTACCTGAAAATGACCGGAACTATTACGGATGTGGAGAAATGCCACGTCATTTTGCTGCAAAGCTGGATAAATACATGTATATTCTTCCATATAAAGAATTTTTTGGTGGTGTAAGTGGGCTGACAGTGGAACAATTTAGAAAGATCAATGGTTTTCCTAATGCCTTCTGGGGATGGGGAGGAGAAGATGATGACCTTTGGAACAGAGTTCACTATGCTGGATATAATGTAACCAGACCAGAGGGAGACTTAGGAAAATACAAGTCAATTCCTCATCACCATAGAGGTGAAGTCCAGTTTTTAGGACGGTATAAATTACTAAGGTATTCCAAGGAGCGTCAGTACATCGATGGACTGAACAATTTAATATATAGGCCAAAAATACTGGTTGATAGGTTGTATACAAACATATCTGTAAACCTCATGCCAGAGTTAGCTCCAATCGAAGACTATTAA
ORF Protein Sequence MSVLRRMMRVSNRSLLAFIFFFSLSSSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTIGHMIRLYTNKNSTLNGTDYPEGNNSSDYLVQTTTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKILVDRLYTNISVNLMPELAPIEDY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0043-Ab Anti-B4GT6/ B4GALT6/ B4Gal-T6 functional antibody
    Target Antigen GM-Tg-g-SE0043-Ag B4GALT6 protein
    ORF Viral Vector pGMLP003618 Human B4GALT6 Lentivirus plasmid
    ORF Viral Vector vGMLP003618 Human B4GALT6 Lentivirus particle


    Target information

    Target ID GM-SE0043
    Target Name B4GALT6
    Gene ID 9331, 56386, 706068, 65196, 101088368, 490499, 524460, 100052209
    Gene Symbol and Synonyms B4Gal-T6,B4GALT6,beta4Gal-T6
    Uniprot Accession Q9UBX8
    Uniprot Entry Name B4GT6_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000118276
    Target Classification Not Available

    This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes in human. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. This gene produces multiple protein isoforms - some of which are predicted to lack the N-terminal hydrophobic signal sequence and transmembrane domain. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The canonical enzyme encoded by this gene is a lactosylceramide synthase important for glycolipid biosynthesis. [provided by RefSeq, Jan 2020]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.