Human PFDN1/PDF/PFD1 ORF/cDNA clone-Lentivirus particle (NM_002622)

Cat. No.: vGMLP003824

Pre-made Human PFDN1/PDF/PFD1 Lentiviral expression plasmid for PFDN1 lentivirus packaging, PFDN1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PFDN1/PDF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003824 Human PFDN1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003824
Gene Name PFDN1
Accession Number NM_002622
Gene ID 5201
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 369 bp
Gene Alias PDF,PFD1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCGCCCCCGTGGATCTAGAGCTGAAGAAGGCCTTCACAGAGCTTCAAGCCAAAGTTATTGACACTCAACAGAAGGTGAAGCTCGCAGACATACAGATTGAACAGCTAAACAGAACGAAAAAGCATGCACATCTTACAGATACAGAGATCATGACTTTGGTAGATGAGACTAACATGTATGAAGGTGTAGGAAGAATGTTTATTCTTCAGTCCAAGGAAGCAATTCACAGTCAGCTGTTAGAGAAGCAGAAAATAGCAGAAGAAAAAATTAAAGAACTAGAACAGAAAAAGTCCTACCTGGAGCGAAGCGTTAAGGAAGCTGAGGACAACATCCGGGAGATGCTGATGGCACGAAGGGCCCAGTAG
ORF Protein Sequence MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1375-Ab Anti-PFDN1 monoclonal antibody
    Target Antigen GM-Tg-g-IP1375-Ag PFDN1 protein
    ORF Viral Vector pGMLP003824 Human PFDN1 Lentivirus plasmid
    ORF Viral Vector vGMLP003824 Human PFDN1 Lentivirus particle


    Target information

    Target ID GM-IP1375
    Target Name PFDN1
    Gene ID 5201, 67199, 697795, 361310, 101093331, 606872, 616553, 100061972
    Gene Symbol and Synonyms 2700086I23Rik,PDF,PFD1,PFDN1
    Uniprot Accession O60925
    Uniprot Entry Name PFD1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000113068
    Target Classification Not Available

    This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.