Human NDFIP1/N4WBP5 ORF/cDNA clone-Lentivirus particle (NM_030571)

Cat. No.: vGMLP003835

Pre-made Human NDFIP1/N4WBP5 Lentiviral expression plasmid for NDFIP1 lentivirus packaging, NDFIP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to NDFIP1/N4WBP5 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003835 Human NDFIP1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003835
Gene Name NDFIP1
Accession Number NM_030571
Gene ID 80762
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 666 bp
Gene Alias N4WBP5
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGTTGGCGTTGGCGGCGCTGGCGGCGGTCGAGCCGGCCTGCGGCAGCCGGTACCAGCAGTTGCAGAATGAAGAAGAGTCTGGAGAACCTGAACAGGCTGCAGGTGATGCTCCTCCACCTTACAGCAGCATTTCTGCAGAGAGCGCAGCATATTTTGACTACAAGGATGAGTCTGGGTTTCCAAAGCCCCCATCTTACAATGTAGCTACAACACTGCCCAGTTATGATGAAGCGGAGAGGACCAAGGCTGAAGCTACTATCCCTTTGGTTCCTGGGAGAGATGAGGATTTTGTGGGTCGGGATGATTTTGATGATGCTGACCAGCTGAGGATAGGAAATGATGGGATTTTCATGTTAACTTTTTTCATGGCATTCCTCTTTAACTGGATTGGGTTTTTCCTGTCTTTTTGCCTGACCACTTCAGCTGCAGGAAGGTATGGGGCCATTTCAGGATTTGGTCTCTCTCTAATTAAATGGATCCTGATTGTCAGGTTTTCCACCTATTTCCCTGGATATTTTGATGGTCAGTACTGGCTCTGGTGGGTGTTCCTTGTTTTAGGCTTTCTCCTGTTTCTCAGAGGATTTATCAATTATGCAAAAGTTCGGAAGATGCCAGAAACTTTCTCAAATCTCCCCAGGACCAGAGTTCTCTTTATTTATTAA
ORF Protein Sequence MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0362-Ab Anti-NFIP1/ NDFIP1/ N4WBP5 functional antibody
    Target Antigen GM-Tg-g-SE0362-Ag NDFIP1 protein
    ORF Viral Vector pGMLP003835 Human NDFIP1 Lentivirus plasmid
    ORF Viral Vector vGMLP003835 Human NDFIP1 Lentivirus particle


    Target information

    Target ID GM-SE0362
    Target Name NDFIP1
    Gene ID 80762, 65113, 705716, 291609, 101080260, 478044, 541196, 100072138
    Gene Symbol and Synonyms 0610010M22Rik,N4WBP5,NDFIP1
    Uniprot Accession Q9BT67
    Uniprot Entry Name NFIP1_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000131507
    Target Classification Not Available

    The protein encoded by this gene belongs to a small group of evolutionarily conserved proteins with three transmembrane domains. It is a potential target for ubiquitination by the Nedd4 family of proteins. This protein is thought to be part of a family of integral Golgi membrane proteins. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.