Human UQCC3/C11orf83/CCDS41658.1 ORF/cDNA clone-Lentivirus particle (NM_001085372)

Cat. No.: vGMLP003837

Pre-made Human UQCC3/C11orf83/CCDS41658.1 Lentiviral expression plasmid for UQCC3 lentivirus packaging, UQCC3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to UQCC3/C11orf83 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003837 Human UQCC3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003837
Gene Name UQCC3
Accession Number NM_001085372
Gene ID 790955
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 282 bp
Gene Alias C11orf83,CCDS41658.1,MC3DN9,UNQ655
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGATTCCTTGCGGAAAATGCTGATCTCAGTCGCAATGCTGGGCGCAGGGGCTGGCGTGGGCTACGCGCTCCTCGTTATCGTGACCCCGGGAGAGCGGCGGAAGCAGGAAATGCTAAAGGAGATGCCACTGCAGGACCCAAGGAGCAGGGAGGAGGCGGCCAGGACCCAGCAGCTATTGCTGGCCACTCTGCAGGAGGCAGCGACCACGCAGGAGAACGTGGCCTGGAGGAAGAACTGGATGGTTGGCGGCGAAGGCGGCGCCGGCGGGAGGTCACCGTGA
ORF Protein Sequence MDSLRKMLISVAMLGAGAGVGYALLVIVTPGERRKQEMLKEMPLQDPRSREEAARTQQLLLATLQEAATTQENVAWRKNWMVGGEGGAGGRSP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0436-Ab Anti-UQCC3 monoclonal antibody
    Target Antigen GM-Tg-g-IP0436-Ag UQCC3 protein
    ORF Viral Vector pGMLP003837 Human UQCC3 Lentivirus plasmid
    ORF Viral Vector vGMLP003837 Human UQCC3 Lentivirus particle


    Target information

    Target ID GM-IP0436
    Target Name UQCC3
    Gene ID 790955, 107197, 718716, 690344, 101087173, 612210, 515452, 100063691
    Gene Symbol and Synonyms C11orf83,C12H11orf83,C14H11orf83,C18H11orf83,C29H11orf83,Cbp4,CCDS41658.1,CD1H11orf83,MC3DN9,UNQ655,UQCC3
    Uniprot Accession Q6UW78
    Uniprot Entry Name UQCC3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000204922
    Target Classification Not Available

    Complex III is a mitochondrial inner membrane protein complex that transfers electrons from ubiquinol to cytochrome c. This gene encodes a protein that functions in complex III assembly. Mutations in this gene result in Mitochondrial complex III deficiency, nuclear type 9. [provided by RefSeq, Dec 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.