Human KLRC4/NKG2-F/NKG2F ORF/cDNA clone-Lentivirus particle (NM_013431)
Cat. No.: vGMLP003839
Pre-made Human KLRC4/NKG2-F/NKG2F Lentiviral expression plasmid for KLRC4 lentivirus packaging, KLRC4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
KLRC4/NKG2-F products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP003839 | Human KLRC4 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP003839 |
| Gene Name | KLRC4 |
| Accession Number | NM_013431 |
| Gene ID | 8302 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 477 bp |
| Gene Alias | NKG2-F,NKG2F |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAATAAACAAAGAGGAACCTACTCAGAAGTGAGTCTGGCCCAGGACCCAAAGAGGCAGCAAAGGAAACTTAAGGGCAATAAAATCTCCATTTCAGGAACCAAACAGGAAATATTCCAAGTAGAATTAAACCTTCAAAATGCTTCTTCGGATCATCAAGGGAATGACAAGACATATCACTGCAAAGGTTTACTGCCACCTCCAGAGAAGCTCACTGCTGAGGTCCTAGGAATCATTTGCATTGTCCTGATGGCCACTGTGTTAAAAACAATAGTTCTTATTCCTTGTATTGGAGTACTGGAGCAGAACAATTTTTCCCTGAATAGAAGAATGCAGAAAGCACGTCATTGTGGCCATTGTCCTGAGGAGTGGATTACATATTCCAACAGTTGTTATTACATTGGTAAGGAAAGAAGAACTTGGGAAGAAAGAGTTTGCTGGCCTGTGCTTCGAAGAACTCTGATCTGCTTTCTATAG |
| ORF Protein Sequence | MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP1058-Ab | Anti-KLRC4 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP1058-Ag | KLRC4 protein |
| ORF Viral Vector | pGMLP003839 | Human KLRC4 Lentivirus plasmid |
| ORF Viral Vector | vGMLP003839 | Human KLRC4 Lentivirus particle |
Target information
| Target ID | GM-IP1058 |
| Target Name | KLRC4 |
| Gene ID | 8302 |
| Gene Symbol and Synonyms | KLRC4,NKG2-F,NKG2F |
| Uniprot Accession | O43908 |
| Uniprot Entry Name | NKG2F_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000183542 |
| Target Classification | Not Available |
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. This gene is a member of the NKG2 group of genes that are expressed primarily in natural killer (NK) cells. These family members encode transmembrane proteins that are characterized by a type II membrane orientation (have an extracellular C-terminus) and the presence of a C-type lectin domain. This family member is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. Read-through transcription exists between this gene and the downstream KLRK1 (killer cell lectin-like receptor subfamily K, member 1) family member. [provided by RefSeq, Dec 2010]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


