Human MZB1/MEDA-7/PACAP ORF/cDNA clone-Lentivirus particle (NM_016459)

Cat. No.: vGMLP003843

Pre-made Human MZB1/MEDA-7/PACAP Lentiviral expression plasmid for MZB1 lentivirus packaging, MZB1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to MZB1/MEDA-7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003843 Human MZB1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003843
Gene Name MZB1
Accession Number NM_016459
Gene ID 51237
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 570 bp
Gene Alias MEDA-7,PACAP,pERp1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGCTGTCACTGCCACTGCTGCTGCTGCTGCTGGGAGCCTGGGCCATCCCAGGGGGCCTCGGGGACAGGGCGCCACTCACAGCCACAGCCCCACAACTGGATGATGAGGAGATGTACTCAGCCCACATGCCCGCTCACCTGCGCTGTGATGCCTGCAGAGCTGTGGCTTACCAGATGTGGCAAAATCTGGCAAAGGCAGAGACCAAACTTCATACCTCAAACTCTGGGGGGCGGCGGGAGCTGAGCGAGTTGGTCTACACGGATGTCCTGGACCGGAGCTGCTCCCGGAACTGGCAGGACTACGGAGTTCGAGAAGTGGACCAAGTGAAACGTCTCACAGGCCCAGGACTTAGCGAGGGGCCAGAGCCAAGCATCAGCGTGATGGTCACAGGGGGCCCCTGGCCTACCAGGCTCTCCAGGACATGTTTGCACTACTTGGGGGAGTTTGGAGAAGACCAGATCTATGAAGCCCACCAACAAGGCCGAGGGGCTCTGGAGGCATTGCTATGTGGGGGACCCCAGGGGGCCTGCTCAGAGAAGGTGTCAGCCACAAGAGAAGAGCTCTAG
ORF Protein Sequence MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1118-Ab Anti-MZB1/ MEDA-7/ PACAP functional antibody
    Target Antigen GM-Tg-g-SE1118-Ag MZB1 protein
    ORF Viral Vector pGMLP003843 Human MZB1 Lentivirus plasmid
    ORF Viral Vector vGMLP003843 Human MZB1 Lentivirus particle


    Target information

    Target ID GM-SE1118
    Target Name MZB1
    Gene ID 51237, 69816, 693572, 291675, 101091341, 100688475, 510480, 100072521
    Gene Symbol and Synonyms 2010001M09Rik,MEDA-7,MZB1,PACAP,pERp1,RGD1310251
    Uniprot Accession Q8WU39
    Uniprot Entry Name MZB1_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000170476
    Target Classification Tumor-associated antigen (TAA)

    Involved in positive regulation of cell population proliferation. Located in cytoplasm and extracellular region. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.