Human RNF182/MGC33993 ORF/cDNA clone-Lentivirus particle (BC030666.1)

Cat. No.: vGMLP003871

Pre-made Human RNF182/MGC33993 Lentiviral expression plasmid for RNF182 lentivirus packaging, RNF182 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RNF182/MGC33993 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003871 Human RNF182 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003871
Gene Name RNF182
Accession Number BC030666.1
Gene ID 221687
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 744 bp
Gene Alias MGC33993
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCAGTCAACCTCCTGAAGACACTGCGGAGTCTCAGGCCTCTGATGAGCTGGAGTGCAAAATCTGTTACAATCGATACAATCTGAAACAGAGGAAACCCAAAGTGCTGGAGTGTTGTCATAGGGTTTGTGCCAAATGCCTCTACAAGATCATAGACTTTGGGGACTCCCCACAAGGTGTCATTGTCTGTCCTTTCTGCAGGTTTGAGACGTGCCTGCCAGATGATGAAGTTAGTAGCCTGCCCGATGACAACAACATCCTTGTAAACTTGACTTGTGGAGGCAAAGGGAAGAAGTGCCTGCCAGAGAACCCTACTGAGCTGCTGCTCACCCCCAAGAGGCTGGCCTCTCTGGTCAGTCCTTCTCACACGTCCTCCAACTGCCTGGTCATAACCATCATGGAGGTGCAGAGAGAGAGCTCCCCGTCCCTGAGCTCCACTCCTGTGGTAGAATTTTATAGGCCTGCGAGTTTCGACTCTGTCACCACTGTGTCACACAACTGGACTGTGTGGAACTGCACGTCCCTGCTGTTTCAGACATCCATCCGGGTGTTAGTGTGGTTGCTAGGTTTGCTCTACTTCAGCTCCTTACCCTTAGGAATCTACTTACTGGTGTCTAAGAAAGTCACCCTTGGGGTCGTCTTTGTCAGCCTGGTCCCTTCGAGCCTCGTTATTCTTATGGTGTATGGTTTTTGCCAGTGTGTTTGTCATGAATTTCTAGACTGTATGGCACCTCCTTCTTAA
ORF Protein Sequence MASQPPEDTAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVPSSLVILMVYGFCQCVCHEFLDCMAPPS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1518-Ab Anti-RNF182 monoclonal antibody
    Target Antigen GM-Tg-g-IP1518-Ag RNF182 protein
    ORF Viral Vector pGMLP003084 Human RNF182 Lentivirus plasmid
    ORF Viral Vector pGMLP003871 Human RNF182 Lentivirus plasmid
    ORF Viral Vector vGMLP003084 Human RNF182 Lentivirus particle
    ORF Viral Vector vGMLP003871 Human RNF182 Lentivirus particle


    Target information

    Target ID GM-IP1518
    Target Name RNF182
    Gene ID 221687, 328234, 707517, 498726, 101089106, 488225, 518996, 102149432
    Gene Symbol and Synonyms C630023L15Rik,RGD1560399,RNF182
    Uniprot Accession Q8N6D2
    Uniprot Entry Name RN182_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000180537
    Target Classification Not Available

    Enables ubiquitin-protein transferase activity. Involved in protein ubiquitination. Located in cytoplasm. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.