Human UBE2S/E2-EPF ORF/cDNA clone-Lentivirus particle (BC004236)

Cat. No.: vGMLP003921

Pre-made Human UBE2S/E2-EPF Lentiviral expression plasmid for UBE2S lentivirus packaging, UBE2S lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to UBE2S/E2-EPF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003921 Human UBE2S Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003921
Gene Name UBE2S
Accession Number BC004236
Gene ID 27338
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 669 bp
Gene Alias E2-EPF
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACTCCAACGTGGAGAACCTACCCCCGCACATCATCCGCCTGGTGTACAAGGAGGTGACGACACTGACCGCAGACCCACCCGATGGCATCAAGGTCTTTCCCAACGAGGAGGACCTCACCGACCTCCAGGTCACCATCGAGGGCCCTGAGGGGACCCCATATGCTGGAGGTCTGTTCCGCATGAAACTCCTGCTGGGGAAGGACTTCCCTGCCTCCCCCCCCAAGGGCTACTTCCTGACCAAGATCTTCCACCCGAACGTGGGCGCCAATGGCGAGATCTGCGTCAACGTGCTCAAGAGGGACTGGACGGCTGAGCTGGGCATCCGACACGTACTGCTGACCATCAAGTGCCTGCTGATCCACCCTAACCCCGAGTCTGCACTCAACGAGGAGGCGGGCCGCCTGCTCTTGGAGAACTACGAGGAGTATGCAGCTCGGGCCCGTCTGCTCACAGAGATCCACGGGGGCGCCGGCGGGCCCAGCGGCAGGGCCGAAGCCGGTCGGGCCCTGGCCAGTGGCACTGAAGCTTCCTCCACCGACCCTGGGGCCCCAGGGGGCCCGGGAGGGGCTGAGGGTCCCATGGCCAAGAAGCATGCTGGCGAGCGCGATAAGAAGCTGGCGGCCAAGAAAAAGACGGACAAGAAGCGGGCGCTGCGGCGGCTGTAG
ORF Protein Sequence MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2798-Ab Anti-UBE2S monoclonal antibody
    Target Antigen GM-Tg-g-IP2798-Ag UBE2S protein
    ORF Viral Vector pGMLP002832 Human UBE2S Lentivirus plasmid
    ORF Viral Vector pGMLP003921 Human UBE2S Lentivirus plasmid
    ORF Viral Vector vGMLP002832 Human UBE2S Lentivirus particle
    ORF Viral Vector vGMLP003921 Human UBE2S Lentivirus particle


    Target information

    Target ID GM-IP2798
    Target Name UBE2S
    Gene ID 27338, 77891, 700592, 292588, 101090565, 403671, 617703, 100055998
    Gene Symbol and Synonyms 0910001J09Rik,6720465F12Rik,E2-EPF,E2EPF,EPF5,RGD1564746,UBE2S
    Uniprot Accession Q16763
    Uniprot Entry Name UBE2S_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000108106
    Target Classification Not Available

    This gene encodes a member of the ubiquitin-conjugating enzyme family. The encoded protein is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.