Human COX11/COX11P ORF/cDNA clone-Lentivirus particle (BC005895)

Cat. No.: vGMLP003925

Pre-made Human COX11/COX11P Lentiviral expression plasmid for COX11 lentivirus packaging, COX11 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to COX11/COX11P products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003925 Human COX11 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003925
Gene Name COX11
Accession Number BC005895
Gene ID 1353
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 831 bp
Gene Alias COX11P
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGAGGGCTCTGGCGTCCTGGATGGAGGTGCGTTCCTTTCTGTGGCTGGCGCTGGATCCACCCTGGGTCTCCAACCAGGGCTGCAGAGAGGGTAGAGCCGTTTCTTAGGCCAGAGTGGAGTGGGACAGGAGGTGCCGAGAGAGGACTGAGGTGGCTTGGGACATGGAAGCGCTGCAGCCTTCGAGCCCGGCATCCAGCATTGCAGCCGCCGCGGCGGCCTAAGAGCTCGAACCCTTTCACACGCGCGCAGGAGGAGGAGCGGCGGCGGCAGAACAAGACGACCCTCACTTACGTGGCCGCTGTCGCCGTGGGCATGCTGGGGGCGTCCTACGCTGCCGTACCCCTTTATCGGCTCTATTGCCAGACTACTGGACTTGGAGGATCAGCAGTTGCAGGTCATGCCTCAGACAAGATTGAAAACATGGTGCCTGTTAAAGATCGAATCATTAAAATTAGCTTTAATGCAGATGTGCATGCAAGTCTCCAGTGGAACTTTAGACCTCAGCAAACAGAAATATATGTGGTGCCAGGAGAGACTGCACTGGCGTTTTACAGAGTTAAGAATCCTACTGACAAACCAGTAATTGGAATTTCTACATACAATATTGTTCCATTTGAAGCTGGACAGTATTTCAATAAAATACAGTGCTTCTGTTTTGAAGAACAAAGGCTTAATCCCCAAGAGGAAGTAGATATGCCAGTGTTTTTCTACATTGATCCTGAATTTGCTGAAGATCCAAGAATGATTAAAGTTGATCTTATCACTCTTTCTTACACTTTTTTTGAAGCAAAGGAAGGGCACAAGTTGCCAGTTCCAGGATATAATTGA
ORF Protein Sequence MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRVKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0594-Ab Anti-COX11 monoclonal antibody
    Target Antigen GM-Tg-g-IP0594-Ag COX11 protein
    ORF Viral Vector pGMLP001229 Human COX11 Lentivirus plasmid
    ORF Viral Vector pGMLP003925 Human COX11 Lentivirus plasmid
    ORF Viral Vector vGMLP001229 Human COX11 Lentivirus particle
    ORF Viral Vector vGMLP003925 Human COX11 Lentivirus particle


    Target information

    Target ID GM-IP0594
    Target Name COX11
    Gene ID 1353, 69802, 641445, 103693419, 101085843, 609555, 510509, 100056543
    Gene Symbol and Synonyms 2010004I09Rik,COX11,COX11P,MC4DN23
    Uniprot Accession Q9Y6N1
    Uniprot Entry Name COX11_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000166260
    Target Classification Not Available

    Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be a heme A biosynthetic enzyme involved in COX formation, according to the yeast mutant studies. However, the studies in Rhodobacter sphaeroides suggest that this gene is not required for heme A biosynthesis, but required for stable formation of the Cu(B) and magnesium centers of COX. This human protein is predicted to contain a transmembrane domain localized in the mitochondrial inner membrane. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene has been found on chromosome 6. [provided by RefSeq, Jun 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.