Human APOA2/Apo-AII/ApoA-II ORF/cDNA clone-Lentivirus particle (NM_001643)

Cat. No.: vGMLP003954

Pre-made Human APOA2/Apo-AII/ApoA-II Lentiviral expression plasmid for APOA2 lentivirus packaging, APOA2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to APOA2/Apo-AII products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003954 Human APOA2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003954
Gene Name APOA2
Accession Number NM_001643
Gene ID 336
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 303 bp
Gene Alias Apo-AII,ApoA-II,apoAII
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGCTGCTCGCAGCAACTGTGCTACTCCTCACCATCTGCAGCCTTGAAGGAGCTTTGGTTCGGAGACAGGCAAAGGAGCCATGTGTGGAGAGCCTGGTTTCTCAGTACTTCCAGACCGTGACTGACTATGGCAAGGACCTGATGGAGAAGGTCAAGAGCCCAGAGCTTCAGGCCGAGGCCAAGTCTTACTTTGAAAAGTCAAAGGAGCAGCTGACACCCCTGATCAAGAAGGCTGGAACGGAACTGGTTAACTTCTTGAGCTATTTCGTGGAACTTGGAACACAGCCTGCCACCCAGTGA
ORF Protein Sequence MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T75655-Ab Anti-APOA2/ Apo-AII/ ApoA-II functional antibody
    Target Antigen GM-Tg-g-T75655-Ag APOA2 protein
    ORF Viral Vector pGMLP003954 Human APOA2 Lentivirus plasmid
    ORF Viral Vector vGMLP003954 Human APOA2 Lentivirus particle


    Target information

    Target ID GM-T75655
    Target Name APOA2
    Gene ID 336, 11807, 719946, 25649, 123378911, 478982, 505394, 100066043
    Gene Symbol and Synonyms Alp-2,Apo-AII,Apoa-2,ApoA-II,APOA2,apoAII,Hdl-1
    Uniprot Accession P02652
    Uniprot Entry Name APOA2_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease prostate cancer, Diabetic Nephropathy, Malignant neoplasm of bladder
    Gene Ensembl ENSG00000158874
    Target Classification Not Available

    This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.