Human TIMM22/TEX4/TIM22 ORF/cDNA clone-Lentivirus particle (NM_013337)
Cat. No.: vGMLP003961
Pre-made Human TIMM22/TEX4/TIM22 Lentiviral expression plasmid for TIMM22 lentivirus packaging, TIMM22 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
TIMM22/TEX4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP003961 | Human TIMM22 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP003961 |
| Gene Name | TIMM22 |
| Accession Number | NM_013337 |
| Gene ID | 29928 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 585 bp |
| Gene Alias | TEX4,TIM22 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCGGCGGCCGCCCCCAATGCCGGAGGCTCGGCCCCTGAGACAGCGGGTTCCGCCGAAGCTCCGCTGCAGTACAGCCTGCTCCTGCAGTACCTGGTGGGTGACAAGCGTCAGCCCCGGCTCCTGGAGCCTGGGAGCCTGGGCGGGATCCCAAGTCCAGCCAAGAGTGAGGAGCAGAAGATGATCGAGAAGGCGATGGAAAGCTGCGCTTTCAAGGCTGCGCTGGCCTGCGTGGGAGGATTTGTCTTAGGAGGTGCATTTGGGGTGTTTACCGCTGGCATCGATACCAACGTGGGCTTTGACCCTAAGGATCCTTACCGTACACCGACTGCAAAAGAAGTGCTGAAAGACATGGGGCAGAGAGGAATGTCCTATGCCAAAAATTTCGCCATTGTGGGAGCCATGTTTTCTTGTACTGAGTGTTTGATAGAATCTTACCGGGGAACATCAGACTGGAAGAACAGTGTCATCAGTGGCTGCATCACGGGAGGAGCTATTGGTTTCAGAGCTGGCTTAAAGGCTGGGGCCATTGGTTGTGGAGGTTTTGCTGCTTTCTCTGCTGCGATTGATTATTACCTCCGGTGA |
| ORF Protein Sequence | MAAAAPNAGGSAPETAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKAMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP1916-Ab | Anti-TIMM22 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP1916-Ag | TIMM22 protein |
| ORF Viral Vector | pGMLP003961 | Human TIMM22 Lentivirus plasmid |
| ORF Viral Vector | vGMLP003961 | Human TIMM22 Lentivirus particle |
Target information
| Target ID | GM-IP1916 |
| Target Name | TIMM22 |
| Gene ID | 29928, 56322, 721162, 79463, 101089408, 480639, 515555, 100059837 |
| Gene Symbol and Synonyms | COXPD43,TEX4,TIM22,TIMM22 |
| Uniprot Accession | Q9Y584 |
| Uniprot Entry Name | TIM22_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000177370 |
| Target Classification | Not Available |
Multipass transmembrane proteins are brought into mitochondria and inserted into the mitochondrial inner membrane by way of the TIM22 complex. This complex has six subunits and is a twin-pore translocase. The protein encoded by this gene is a subunit of TIM22 and represents the voltage-activated and signal-gated channel. [provided by RefSeq, Jul 2016]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


