Human TIMM22/TEX4/TIM22 ORF/cDNA clone-Lentivirus particle (NM_013337)

Cat. No.: vGMLP003961

Pre-made Human TIMM22/TEX4/TIM22 Lentiviral expression plasmid for TIMM22 lentivirus packaging, TIMM22 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TIMM22/TEX4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003961 Human TIMM22 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003961
Gene Name TIMM22
Accession Number NM_013337
Gene ID 29928
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 585 bp
Gene Alias TEX4,TIM22
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCGGCCGCCCCCAATGCCGGAGGCTCGGCCCCTGAGACAGCGGGTTCCGCCGAAGCTCCGCTGCAGTACAGCCTGCTCCTGCAGTACCTGGTGGGTGACAAGCGTCAGCCCCGGCTCCTGGAGCCTGGGAGCCTGGGCGGGATCCCAAGTCCAGCCAAGAGTGAGGAGCAGAAGATGATCGAGAAGGCGATGGAAAGCTGCGCTTTCAAGGCTGCGCTGGCCTGCGTGGGAGGATTTGTCTTAGGAGGTGCATTTGGGGTGTTTACCGCTGGCATCGATACCAACGTGGGCTTTGACCCTAAGGATCCTTACCGTACACCGACTGCAAAAGAAGTGCTGAAAGACATGGGGCAGAGAGGAATGTCCTATGCCAAAAATTTCGCCATTGTGGGAGCCATGTTTTCTTGTACTGAGTGTTTGATAGAATCTTACCGGGGAACATCAGACTGGAAGAACAGTGTCATCAGTGGCTGCATCACGGGAGGAGCTATTGGTTTCAGAGCTGGCTTAAAGGCTGGGGCCATTGGTTGTGGAGGTTTTGCTGCTTTCTCTGCTGCGATTGATTATTACCTCCGGTGA
ORF Protein Sequence MAAAAPNAGGSAPETAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKAMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1916-Ab Anti-TIMM22 monoclonal antibody
    Target Antigen GM-Tg-g-IP1916-Ag TIMM22 protein
    ORF Viral Vector pGMLP003961 Human TIMM22 Lentivirus plasmid
    ORF Viral Vector vGMLP003961 Human TIMM22 Lentivirus particle


    Target information

    Target ID GM-IP1916
    Target Name TIMM22
    Gene ID 29928, 56322, 721162, 79463, 101089408, 480639, 515555, 100059837
    Gene Symbol and Synonyms COXPD43,TEX4,TIM22,TIMM22
    Uniprot Accession Q9Y584
    Uniprot Entry Name TIM22_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000177370
    Target Classification Not Available

    Multipass transmembrane proteins are brought into mitochondria and inserted into the mitochondrial inner membrane by way of the TIM22 complex. This complex has six subunits and is a twin-pore translocase. The protein encoded by this gene is a subunit of TIM22 and represents the voltage-activated and signal-gated channel. [provided by RefSeq, Jul 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.