Human ZDHHC19/DHHC19 ORF/cDNA clone-Lentivirus particle (NM_001039617.1)

Cat. No.: vGMLP004039

Pre-made Human ZDHHC19/DHHC19 Lentiviral expression plasmid for ZDHHC19 lentivirus packaging, ZDHHC19 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to ZDHHC19/DHHC19 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004039 Human ZDHHC19 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004039
Gene Name ZDHHC19
Accession Number NM_001039617.1
Gene ID 131540
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 930 bp
Gene Alias DHHC19
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACACTCTTAACGGATGCCACGCCGCTGGTGAAGGAGCCCCATCCCCTGCCTCTGGTCCCACGTCCCTGGTTCCTCCCTAGCCTCTTTGCTGCCTTCAATGTGGTGCTGCTGGTCTTTTTCAGTGGCCTCTTCTTCGCATTCCCTTGCAGGTGGCTGGCTCAGAACGGGGAGTGGGCCTTTCCTGTTATCACAGGCTCCCTCTTTGTCCTTACCTTCTTCAGTCTTGTTTCACTCAACTTCTCAGACCCTGGCATCTTACATCAAGGCTCCGCTGAGCAGGGCCCCTTGACGGTGCACGTGGTGTGGGTGAACCACGGGGCCTTCCGCCTGCAATGGTGTCCAAAGTGCTGCTTCCACCGCCCGCCCCGGACTTACCACTGCCCCTGGTGCAACATCTGTGTGGAGGACTTTGACCACCACTGCAAGTGGGTCAATAACTGCATCGGTCACCGCAACTTCCGCTTCTTCATGCTGCTTGTCCTGTCCCTGTGCCTCTACTCGGGCGCCATGCTGGTCACCTGTCTCATCTTCCTGGTGCGCACAACCCACCTGCCCTTCTCCACCGACAAGGCCATCGCCATCGTGGTGGCCGTGTCCGCCGCGGGCCTCCTGGTGCCGCTGTCCCTCCTGCTGCTGATCCAGGCACTGTCCGTGAGCTCGGCCGACCGCACCTACAAGGGCAAGTGCAGACACCTTCAGGGATACAACCCCTTCGACCAGGGCTGTGCCAGCAACTGGTATTTAACAATTTGTGCACCACTGGGACCCAAGTACATGGCTGAAGCTGTCCAGCTGCAGAGAGTGGTGGGGCCTGACTGGACATCCATGCCGAATCTGCACCCTCCAATGTCCCCCTCTGCTCTCAACCCCCCAGCCCCAACCTCTGGGTCCCTACAAAGCAGGGAAGGGACCCCCGGGGCGTGGTGA
ORF Protein Sequence MTLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCRWLAQNGEWAFPVITGSLFVLTFFSLVSLNFSDPGILHQGSAEQGPLTVHVVWVNHGAFRLQWCPKCCFHRPPRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRFFMLLVLSLCLYSGAMLVTCLIFLVRTTHLPFSTDKAIAIVVAVSAAGLLVPLSLLLLIQALSVSSADRTYKGKCRHLQGYNPFDQGCASNWYLTICAPLGPKYMAEAVQLQRVVGPDWTSMPNLHPPMSPSALNPPAPTSGSLQSREGTPGAW

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2306-Ab Anti-ZDHHC19 monoclonal antibody
    Target Antigen GM-Tg-g-IP2306-Ag ZDHHC19 protein
    ORF Viral Vector pGMLP004039 Human ZDHHC19 Lentivirus plasmid
    ORF Viral Vector pGMPC004871 Human ZDHHC19 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP004039 Human ZDHHC19 Lentivirus particle


    Target information

    Target ID GM-IP2306
    Target Name ZDHHC19
    Gene ID 131540, 245308, 710811, 288045, 111556194, 609406, 514466, 111768970
    Gene Symbol and Synonyms DHHC19,Gm1744,Gm616,RGD1560310,ZDHHC19
    Uniprot Accession Q8WVZ1
    Uniprot Entry Name ZDH19_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000163958
    Target Classification Not Available

    Enables protein-cysteine S-palmitoyltransferase activity. Involved in peptidyl-L-cysteine S-palmitoylation. Located in Golgi membrane; endoplasmic reticulum; and perinucleolar compartment. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.