Human SGCA/50DAG/adhalin ORF/cDNA clone-Lentivirus particle (NM_000023.3)

Cat. No.: vGMLP004080

Pre-made Human SGCA/50DAG/adhalin Lentiviral expression plasmid for SGCA lentivirus packaging, SGCA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SGCA/50DAG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004080 Human SGCA Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004080
Gene Name SGCA
Accession Number NM_000023.3
Gene ID 6442
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1164 bp
Gene Alias 50DAG,adhalin,ADL,DAG2,DMDA2,LGMD2D,SCARMD1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGAGACACTCTTCTGGACTCCTCTCCTCGTGGTTCTCCTGGCAGGGCTGGGGGACACCGAGGCCCAGCAGACCACGCTACACCCACTTGTGGGCCGTGTCTTTGTGCACACCTTGGACCATGAGACGTTTCTGAGCCTTCCTGAGCATGTCGCTGTCCCACCCGCTGTCCACATCACCTACCACGCCCACCTCCAGGGACACCCAGACCTGCCCCGGTGGCTCCGCTACACCCAGCGCAGCCCCCACCACCCTGGCTTCCTCTACGGCTCTGCCACCCCAGAAGATCGTGGGCTCCAGGTCATTGAGGTCACAGCCTACAATCGGGACAGCTTTGATACCACTCGGCAGAGGCTGGTGCTGGAGATTGGGGACCCAGAAGGCCCCCTGCTGCCATACCAAGCCGAGTTCCTGGTGCGCAGCCACGATGCGGAGGAGGTGCTGCCCTCAACACCTGCCAGCCGCTTCCTCTCAGCCTTGGGGGGACTCTGGGAGCCCGGAGAGCTTCAGCTGCTCAACGTCACCTCTGCCTTGGACCGTGGGGGCCGTGTCCCCCTTCCCATTGAGGGCCGAAAAGAAGGGGTATACATTAAGGTGGGTTCTGCCTCACCTTTTTCTACTTGCCTGAAGATGGTGGCATCCCCCGATAGCCACGCCCGCTGTGCCCAGGGCCAGCCTCCACTTCTGTCTTGCTACGACACCTTGGCACCCCACTTCCGCGTTGACTGGTGCAATGTGACCCTGGTGGATAAGTCAGTGCCGGAGCCTGCAGATGAGGTGCCCACCCCAGGTGATGGGATCCTGGAGCATGACCCGTTCTTCTGCCCACCCACTGAGGCCCCAGACCGTGACTTCTTGGTGGATGCTCTGGTCACCCTCCTGGTGCCCCTGCTGGTGGCCCTGCTTCTCACCTTGCTGCTGGCCTATGTCATGTGCTGCCGGCGGGAGGGAAGGCTGAAGAGAGACCTGGCTACCTCCGACATCCAGATGGTCCACCACTGCACCATCCACGGGAACACAGAGGAGCTGCGGCAGATGGCGGCCAGCCGCGAGGTGCCCCGGCCACTCTCCACCCTGCCCATGTTCAATGTGCACACAGGTGAGCGGCTGCCTCCCCGCGTGGACAGCGCCCAGGTGCCCCTCATTCTGGACCAGCACTGA
ORF Protein Sequence MAETLFWTPLLVVLLAGLGDTEAQQTTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLPYQAEFLVRSHDAEEVLPSTPASRFLSALGGLWEPGELQLLNVTSALDRGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHFRVDWCNVTLVDKSVPEPADEVPTPGDGILEHDPFFCPPTEAPDRDFLVDALVTLLVPLLVALLLTLLLAYVMCCRREGRLKRDLATSDIQMVHHCTIHGNTEELRQMAASREVPRPLSTLPMFNVHTGERLPPRVDSAQVPLILDQH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T84584-Ab Anti-SGCA/ 50DAG/ ADL functional antibody
    Target Antigen GM-Tg-g-T84584-Ag SGCA protein
    ORF Viral Vector pGMLP002921 Human SGCA Lentivirus plasmid
    ORF Viral Vector pGMLP004080 Human SGCA Lentivirus plasmid
    ORF Viral Vector vGMLP002921 Human SGCA Lentivirus particle
    ORF Viral Vector vGMLP004080 Human SGCA Lentivirus particle


    Target information

    Target ID GM-T84584
    Target Name SGCA
    Gene ID 6442, 20391, 704493, 303468, 101092469, 609265, 541308, 100056285
    Gene Symbol and Synonyms 50DAG,adhalin,ADL,Asg,DAG2,DMDA2,LGMD2D,LGMDR3,SCARMD1,SGCA
    Uniprot Accession Q16586
    Uniprot Entry Name SGCA_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Prostate Cancer
    Gene Ensembl ENSG00000108823
    Target Classification Not Available

    This gene encodes a component of the dystrophin-glycoprotein complex (DGC), which is critical to the stability of muscle fiber membranes and to the linking of the actin cytoskeleton to the extracellular matrix. Its expression is thought to be restricted to striated muscle. Mutations in this gene result in type 2D autosomal recessive limb-girdle muscular dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.