Human C19orf12/MPAN/NBIA3 ORF/cDNA clone-Lentivirus particle (NM_001031726)
Cat. No.: vGMLP004165
Pre-made Human C19orf12/MPAN/NBIA3 Lentiviral expression plasmid for C19orf12 lentivirus packaging, C19orf12 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
C19orf12/MPAN products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP004165 | Human C19orf12 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP004165 |
Gene Name | C19orf12 |
Accession Number | NM_001031726 |
Gene ID | 83636 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 459 bp |
Gene Alias | MPAN,NBIA3,NBIA4,SPG43 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGACTATCATGGTGGAGGACATCATGAAGCTGCTGTGCTCCCTTTCTGGGGAGAGGAAGATGAAGGCGGCTGTCAAGCACTCTGGGAAGGGTGCCCTGGTCACAGGGGCCATGGCCTTCGTCGGGGGTTTGGTGGGCGGCCCACCGGGACTCGCCGTTGGGGGGGCTGTCGGGGGGCTGTTAGGTGCCTGGATGACAAGTGGACAGTTTAAGCCGGTTCCTCAGATCCTAATGGAGCTGCCCCCTGCCGAGCAACAGAGGCTCTTTAACGAAGCCGCAGCCATCATCAGGCACCTGGAGTGGACGGACGCCGTGCAGCTGACCGCGCTGGTCATGGGCAGCGAGGCCCTGCAGCAGCAGCTGCTGGCCATGCTGGTGAACTACGTCACCAAGGAGCTGCGGGCCGAGATCCAGTATGATGACTAG |
ORF Protein Sequence | MTIMVEDIMKLLCSLSGERKMKAAVKHSGKGALVTGAMAFVGGLVGGPPGLAVGGAVGGLLGAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTALVMGSEALQQQLLAMLVNYVTKELRAEIQYDD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP0452-Ab | Anti-C19orf12 monoclonal antibody |
Target Antigen | GM-Tg-g-IP0452-Ag | C19orf12 protein |
ORF Viral Vector | pGMLP004165 | Human C19orf12 Lentivirus plasmid |
ORF Viral Vector | vGMLP004165 | Human C19orf12 Lentivirus particle |
Target information
Target ID | GM-IP0452 |
Target Name | C19orf12 |
Gene ID | 83636, 72244, 710444, 690000, 101093564, 119870989, 533209, 100053776 |
Gene Symbol and Synonyms | 1600014C10Rik,C10H19orf12,C18H19orf12,C19H19orf12,C19orf12,C1H19orf12,CE2H19orf12,LOC690000,MPAN,NBIA3,NBIA4,SPG43 |
Uniprot Accession | Q9NSK7 |
Uniprot Entry Name | CS012_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000131943 |
Target Classification | Not Available |
This gene encodes a small transmembrane protein. Mutations in this gene are a cause of neurodegeneration with brain iron accumulation-4 (NBIA4), but the specific function of the encoded protein is unknown. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.