Human MFAP5/AAT9/MAGP-2 ORF/cDNA clone-Lentivirus particle (NM_003480)

Cat. No.: vGMLP004222

Pre-made Human MFAP5/AAT9/MAGP-2 Lentiviral expression plasmid for MFAP5 lentivirus packaging, MFAP5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to MFAP5/AAT9 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004222 Human MFAP5 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004222
Gene Name MFAP5
Accession Number NM_003480
Gene ID 8076
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 522 bp
Gene Alias AAT9,MAGP-2,MAGP2,MFAP-5,MP25
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCGCTCTTGGGACCCAAGGTGCTGCTGTTTCTTGCTGCATTCATCATCACCTCTGACTGGATACCCCTGGGGGTCAATAGTCAACGAGGAGACGATGTGACTCAAGCGACTCCAGAAACATTCACAGAAGATCCTAATCTGGTGAATGATCCCGCTACAGATGAAACAGTTTTGGCTGTTTTGGCTGATATTGCACCTTCCACAGATGACTTGGCCTCCCTCAGTGAAAAAAATACCACTGCAGAGTGCTGGGATGAGAAATTTACCTGCACAAGGCTCTACTCTGTGCATCGGCCGGTTAAACAATGCATTCATCAGTTATGCTTCACCAGTTTACGACGTATGTACATCGTCAACAAGGAGATCTGCTCTCGTCTTGTCTGTAAGGAACACGAAGCTATGAAAGATGAGCTTTGCCGTCAGATGGCTGGTCTGCCCCCTAGGAGACTCCGTCGCTCCAATTACTTCCGACTTCCTCCCTGTGAAAATGTGGATTTGCAGAGACCCAATGGTCTGTGA
ORF Protein Sequence MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0342-Ab Anti-MFAP5/ AAT9/ MAGP-2 functional antibody
    Target Antigen GM-Tg-g-SE0342-Ag MFAP5 protein
    ORF Viral Vector pGMLP004222 Human MFAP5 Lentivirus plasmid
    ORF Viral Vector vGMLP004222 Human MFAP5 Lentivirus particle


    Target information

    Target ID GM-SE0342
    Target Name MFAP5
    Gene ID 8076, 50530, 716459, 362429, 101097495, 477701, 281908, 100061202
    Gene Symbol and Synonyms AAT9,MAGP-2,MAGP2,MFAP-5,MFAP5,MP25
    Uniprot Accession Q13361
    Uniprot Entry Name MFAP5_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Prostate Cancer
    Gene Ensembl ENSG00000197614
    Target Classification Not Available

    This gene encodes a 25-kD microfibril-associated glycoprotein which is a component of microfibrils of the extracellular matrix. The encoded protein promotes attachment of cells to microfibrils via alpha-V-beta-3 integrin. Deficiency of this gene in mice results in neutropenia. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.