Human DDIT4L/REDD2/Rtp801L ORF/cDNA clone-Lentivirus particle (NM_145244)

Cat. No.: vGMLP004305

Pre-made Human DDIT4L/REDD2/Rtp801L Lentiviral expression plasmid for DDIT4L lentivirus packaging, DDIT4L lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to DDIT4L/REDD2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004305 Human DDIT4L Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004305
Gene Name DDIT4L
Accession Number NM_145244
Gene ID 115265
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 582 bp
Gene Alias REDD2,Rtp801L
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTTGCAACTGGCAGTTTGAGCAGCAAGAACCCGGCCAGCATTTCAGAATTGCTGGACTGTGGCTATCACCCAGAGAGCCTGCTAAGTGATTTTGACTACTGGGATTATGTTGTTCCTGAACCCAACCTCAACGAGGTAATATTTGAGGAATCAACTTGCCAGAATTTGGTTAAAATGCTGGAGAACTGTCTGTCCAAATCAAAGCAAACTAAACTTGGTTGCTCAAAGGTCCTTGTCCCTGAGAAACTGACCCAGAGAATTGCTCAAGATGTCCTGCGGCTTTCCTCAACGGAGCCCTGCGGCTTGCGAGGTTGTGTTATGCACGTGAACTTGGAAATTGAAAATGTATGTAAAAAGCTGGATAGGATTGTGTGTGATTCTAGCGTCGTACCTACTTTTGAGCTTACACTTGTGTTTAAGCAGGAGAACTGCTCATGGACTAGCTTCAGGGACTTTTTCTTTAGTAGAGGTCGCTTCTCCTCTGGTTTCAGGAGAACTCTGATCCTCAGCTCAGGATTTCGACTTGTTAAGAAAAAACTTTACTCACTGATTGGAACAACAGTGATTGAAGGGTCCTAA
ORF Protein Sequence MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2451-Ab Anti-DDIT4L monoclonal antibody
    Target Antigen GM-Tg-g-IP2451-Ag DDIT4L protein
    ORF Viral Vector pGMLP004305 Human DDIT4L Lentivirus plasmid
    ORF Viral Vector vGMLP004305 Human DDIT4L Lentivirus particle


    Target information

    Target ID GM-IP2451
    Target Name DDIT4L
    Gene ID 115265, 73284, 709499, 100363484, 101098139, 487877, 510906, 100067076
    Gene Symbol and Synonyms 1700037B15Rik,1700108M02Rik,DDIT4L,REDD2,Rtp801L,Smhs1
    Uniprot Accession Q96D03
    Uniprot Entry Name DDT4L_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000145358
    Target Classification Not Available

    Predicted to be involved in negative regulation of signal transduction. Predicted to be located in cytoplasm. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.