Human SERP1/RAMP4 ORF/cDNA clone-Lentivirus particle (NM_014445)

Cat. No.: vGMLP004326

Pre-made Human SERP1/RAMP4 Lentiviral expression plasmid for SERP1 lentivirus packaging, SERP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SERP1/RAMP4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004326 Human SERP1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004326
Gene Name SERP1
Accession Number NM_014445
Gene ID 27230
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 201 bp
Gene Alias RAMP4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTCGCCAAGCAAAGGATCCGTATGGCCAACGAGAAGCACAGCAAGAACATCACCCAGCGCGGCAACGTCGCCAAGACCTCGAGAAATGCCCCCGAAGAGAAGGCGTCTGTAGGACCCTGGTTATTGGCTCTCTTCATTTTTGTTGTCTGTGGTTCTGCAATTTTCCAGATTATTCAAAGTATCAGGATGGGCATGTGA
ORF Protein Sequence MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1614-Ab Anti-SERP1 monoclonal antibody
    Target Antigen GM-Tg-g-IP1614-Ag SERP1 protein
    ORF Viral Vector pGMLP004326 Human SERP1 Lentivirus plasmid
    ORF Viral Vector vGMLP004326 Human SERP1 Lentivirus particle


    Target information

    Target ID GM-IP1614
    Target Name SERP1
    Gene ID 27230, 28146, 106997040, 80881, 101095365, 119865423, 528100, 102150364
    Gene Symbol and Synonyms D3Ucla1,RAMP4,SERP1
    Uniprot Accession Q9Y6X1
    Uniprot Entry Name SERP1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Prostate Cancer
    Gene Ensembl ENSG00000120742
    Target Classification Not Available

    Predicted to be involved in endoplasmic reticulum unfolded protein response and protein glycosylation. Predicted to act upstream of or within several processes, including multicellular organism aging; positive regulation of organ growth; and positive regulation of peptide hormone secretion. Located in cytoplasmic microtubule. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.