Human LMO2/LMO-2/RBTN2 ORF/cDNA clone-Lentivirus particle (NM_005574)

Cat. No.: vGMLP004463

Pre-made Human LMO2/LMO-2/RBTN2 Lentiviral expression plasmid for LMO2 lentivirus packaging, LMO2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to LMO2/LMO-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004463 Human LMO2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004463
Gene Name LMO2
Accession Number NM_005574
Gene ID 4005
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 684 bp
Gene Alias LMO-2,RBTN2,RBTNL1,RHOM2,TTG2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAAGGGAGCGCGGTGACTGTCCTTGAGCGCGGAGGGGCGAGCTCGCCGGCGGAGCGCCGGAGCAAGCGGAGGCGCAGGAGCGGCGGCGACGGCGGCGGCGGCGGCGGCGCCCGAGCACCCGAGGGGGTCCGAGCCCCGGCAGCCGGCCAGCCCCGCGCCACAAAGGGAGCGCCCCCGCCGCCCGGCACCCCGCCTCCCTCCCCAATGTCCTCGGCCATCGAAAGGAAGAGCCTGGACCCTTCAGAGGAACCAGTGGATGAGGTGCTGCAGATCCCCCCATCCCTGCTGACATGCGGCGGCTGCCAGCAGAACATTGGGGACCGCTACTTCCTGAAGGCCATCGACCAGTACTGGCACGAGGACTGCCTGAGCTGCGACCTCTGTGGCTGCCGGCTGGGTGAGGTGGGGCGGCGCCTCTACTACAAACTGGGCCGGAAGCTCTGCCGGAGAGACTATCTCAGGCTTTTTGGGCAAGACGGTCTCTGCGCATCCTGTGACAAGCGGATTCGTGCCTATGAGATGACAATGCGGGTGAAAGACAAAGTGTATCACCTGGAATGTTTCAAATGCGCCGCCTGTCAGAAGCATTTCTGTGTAGGTGACAGATACCTCCTCATCAACTCTGACATAGTGTGCGAACAGGACATCTACGAGTGGACTAAGATCAATGGGATGATATAG
ORF Protein Sequence MEGSAVTVLERGGASSPAERRSKRRRRSGGDGGGGGGARAPEGVRAPAAGQPRATKGAPPPPGTPPPSPMSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T88321-Ab Anti-LMO2 monoclonal antibody
    Target Antigen GM-Tg-g-T88321-Ag LMO2 protein
    ORF Viral Vector pGMLP004463 Human LMO2 Lentivirus plasmid
    ORF Viral Vector vGMLP004463 Human LMO2 Lentivirus particle


    Target information

    Target ID GM-T88321
    Target Name LMO2
    Gene ID 4005, 16909, 717502, 362176, 101092888, 119864212, 614876, 100060270
    Gene Symbol and Synonyms LMO-2,LMO2,Rbtn-2,RBTN2,RBTNL1,Rhom-2,RHOM2,TTG2
    Uniprot Accession P25791
    Uniprot Entry Name RBTN2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000135363
    Target Classification Tumor-associated antigen (TAA)

    LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Nov 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.